SimulationCraft has not been built with PTR data.  The 'ptr=' option is ignored.
Simc does not support overlapping add spawning in a single raid event (duration of 44.000s > reasonable minimum cooldown of 15.000s).
close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Druid

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-06-14 Balance T20 4pc now last for 20 seconds.
(effect#1) duration 0.00 0.00 Verification Failure (15.00)
2017-06-14 Feral T20 4pc now only increase duration by 4 seconds
Item - Druid T20 Feral 4P Bonus (effect#2) base_value 4000.00 4000.00 Verification Failure (8000.00)
2017-06-14 Feral T20 4pc reduced to 10% damage increase
Item - Druid T20 Feral 4P Bonus (effect#1) base_value 10.00 10.00 Verification Failure (15.00)
2017-06-14 Feral T20 2pc reduced to 1 energy per tick from 2
Energetic Rip (effect#1) base_value 1.00 1.00 Verification Failure (2.00)

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Current simulator-wide DBC data overrides

Spell / Effect Field Override Value DBC Value
Smoldering Heart (effect#2) base_value 10.00 20.00
Lava Burst (effect#1) sp_coefficient 2.83 2.75
Lava Burst Overload (effect#1) sp_coefficient 2.83 2.75
Chain Lightning (effect#1) sp_coefficient 1.65 1.60
Chain Lightning Overload (effect#1) sp_coefficient 1.65 1.60
Lightning Bolt (effect#1) sp_coefficient 1.80 1.75
Lightning Bolt Overload (effect#1) sp_coefficient 1.80 1.75
Elemental Blast (effect#1) sp_coefficient 7.00 6.80
Elemental Blast Overload (effect#1) sp_coefficient 7.00 6.80
Icefury (effect#1) sp_coefficient 9.27 9.00
Icefury Overload (effect#1) sp_coefficient 9.27 9.00
Earth Shock (effect#1) sp_coefficient 11.85 11.50
Flame Shock (effect#1) sp_coefficient 0.82 0.80
Flame Shock (effect#2) sp_coefficient 0.41 0.40
Frost Shock (effect#1) sp_coefficient 0.82 0.80
Volcanic Inferno (effect#1) sp_coefficient 0.62 0.60
Fire Blast (effect#1) sp_coefficient 2.78 2.70
Lightning Blast (effect#1) sp_coefficient 2.06 2.00

Table of Contents

Raid Summary

 

Raid Event List
0 adds,name=Pack_Beast,count=6,first=15,duration=10,cooldown=30,angle_start=0,angle_end=360,distance=3
1 adds,name=Heavy_Spear,count=2,first=15,duration=15,cooldown=20,spawn_x=-15,spawn_y=0,distance=15
2 movement,first=13,distance=5,cooldown=20,players_only=1,player_chance=0.1
3 adds,name=Beast,count=1,first=10,duration=44,cooldown=75,last=195,duration_stddev=5,cooldown_stddev=10

Actions per Minute / DPS Variance Summary

3ilevel : 2173103 dps, 1063077 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2173103.0 2173103.0 2604.7 / 0.120% 392022.6 / 18.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
3ilevel 2173103
Chain Lightning 195674 (425609) 9.0% (19.7%) 41.8 6.44sec 3060180 2343243 Direct 166.1 245095 706582 354377 23.7%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.83 166.08 0.00 0.00 1.3060 0.0000 58854973.58 58854973.58 0.00 2343242.55 2343242.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 126.75 76.32% 245094.74 150833 564631 245809.89 165555 327825 31065781 31065781 0.00
crit 39.33 23.68% 706582.15 441037 1650980 708753.14 478607 1006114 27789192 27789192 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 229935 10.6% 51.0 9.52sec 1357037 0 Direct 226.7 211373 608958 304982 23.5%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.96 226.73 0.00 0.00 0.0000 0.0000 69151680.51 69151680.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.35 76.46% 211372.88 126700 474290 211733.08 137028 317702 36641477 36641477 0.00
crit 53.38 23.54% 608957.74 370471 1386823 610887.46 400493 1022537 32510203 32510203 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 65823 3.0% 9.5 31.55sec 2078446 2110753 Direct 9.5 1392921 4077991 2078198 25.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.50 9.50 0.00 0.00 0.9848 0.0000 19754538.64 19754538.64 0.00 2110753.14 2110753.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.08 74.47% 1392920.87 115276 1634572 1395219.41 784594 1583837 9860081 9860081 0.00
crit 2.43 25.53% 4077990.87 337068 4779488 3784011.10 0 4779488 9894457 9894457 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (729924) 0.0% (33.6%) 48.2 5.86sec 4539132 4497173

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.21 0.00 0.00 0.00 1.0093 0.0000 0.00 0.00 0.00 4497172.85 4497172.85
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 534450 24.6% 286.0 0.98sec 560292 0 Direct 1464.0 76438 223505 109446 22.4%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 285.97 1463.96 0.00 0.00 0.0000 0.0000 160227495.46 160227495.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1135.38 77.56% 76438.41 68205 85106 76467.51 73522 80799 86787044 86787044 0.00
crit 328.58 22.44% 223504.53 199430 248849 223594.11 214109 235747 73440451 73440451 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 195475 9.0% 73.2 4.40sec 800496 0 Direct 73.2 559426 1635375 800519 22.4%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.22 73.22 0.00 0.00 0.0000 0.0000 58609432.72 58609432.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.81 77.59% 559426.35 533891 605629 559546.74 541028 588595 31782326 31782326 0.00
crit 16.40 22.41% 1635374.74 1561098 1770858 1635761.68 1561098 1740892 26827106 26827106 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 59339 (90729) 2.7% (4.2%) 19.9 15.29sec 1365123 1007044 Direct 19.9 603263 1765727 892866 24.9%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.93 19.93 0.00 0.00 1.3556 0.0000 17791380.38 17791380.38 0.00 1007043.72 1007043.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.96 75.08% 603262.76 534196 666572 603395.50 574619 633261 9025141 9025141 0.00
crit 4.96 24.92% 1765726.80 1561990 1949057 1759964.68 0 1949057 8766240 8766240 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 31389 1.4% 12.6 23.52sec 748269 0 Direct 12.6 506903 1481935 748309 24.8%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.57 12.57 0.00 0.00 0.0000 0.0000 9408870.41 9408870.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.46 75.25% 506902.83 448725 559921 507074.29 466253 552743 4796035 4796035 0.00
crit 3.11 24.75% 1481935.45 1312071 1637208 1432194.68 0 1637208 4612835 4612835 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 178823 8.2% 26.3 11.28sec 2033489 2055815 Direct 26.3 89213 266807 220870 74.1%  
Periodic 301.8 48713 198119 157923 73.1% 133.1%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.30 26.30 301.83 301.83 0.9892 1.3234 53475856.33 53475856.33 0.00 125691.87 2055814.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.80 25.86% 89213.06 79768 99535 89091.80 0 99535 606724 606724 0.00
crit 19.50 74.14% 266807.32 233243 291041 266627.04 250003 282649 5201883 5201883 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.2 26.90% 48713.48 34 54745 48698.91 43733 51631 3955596 3955596 0.00
crit 220.6 73.10% 198118.87 140 224105 198017.16 182962 209596 43711654 43711654 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14537 0.7% 5.1 60.37sec 852693 0 Periodic 48.0 73511 149451 90958 23.0% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.99 47.99 0.0000 1.2509 4365022.46 4365022.46 0.00 72712.81 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.0 77.03% 73510.73 228 76542 73500.83 69819 76542 2717596 2717596 0.00
crit 11.0 22.97% 149450.61 233 156146 149390.72 109847 156146 1647427 1647427 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 61686 (139013) 2.8% (6.3%) 7.5 28.82sec 5477132 4543378 Direct 36.0 356066 1040174 506683 22.0%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.50 36.02 0.00 0.00 1.2056 0.0000 18247538.95 18247538.95 0.00 4543378.20 4543378.20
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.09 77.98% 356066.16 174249 918285 356786.47 220372 535467 9998976 9998976 0.00
crit 7.93 22.02% 1040173.80 509505 2685066 1039621.41 0 2452064 8248562 8248562 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 77327 3.5% 11.1 40.92sec 2058401 0 Direct 54.6 294256 858638 418924 22.1%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.10 54.57 0.00 0.00 0.0000 0.0000 22856403.66 22856403.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.51 77.91% 294255.75 146368 771354 295017.89 183618 561985 12509333 12509333 0.00
crit 12.05 22.09% 858637.62 427981 2255438 861559.06 446652 2050398 10347071 10347071 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 162991 (265460) 7.5% (12.2%) 55.6 5.31sec 1428287 1211750 Direct 55.6 256588 877250 877213 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.59 55.59 0.00 0.00 1.1787 0.0000 48762877.45 48762877.45 0.00 1211750.03 1211750.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 256587.81 232655 290307 839.10 0 290307 839 839 0.00
crit 55.59 99.99% 877249.51 751903 1208741 877841.60 842757 919802 48762038 48762038 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 83280 3.8% 35.4 8.31sec 704494 0 Direct 35.4 216998 704531 704503 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.35 35.35 0.00 0.00 0.0000 0.0000 24904656.66 24904656.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 216998.35 195430 234480 448.19 0 234480 448 448 0.00
crit 35.35 99.99% 704531.19 603957 970906 705017.23 666433 768605 24904208 24904208 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 19189 0.9% 41.6 6.68sec 137763 0 Direct 96.1 47550 96927 59589 24.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.58 96.14 0.00 0.00 0.0000 0.0000 5728751.38 5728751.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.70 75.62% 47550.10 45328 51418 47547.55 45328 50672 3456879 3456879 0.00
crit 23.44 24.38% 96927.46 92469 104893 96937.91 92469 104086 2271872 2271872 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 43712 (84878) 2.0% (3.9%) 38.4 7.60sec 664354 523072 Direct 38.4 230606 658889 342092 26.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.42 38.42 0.00 0.00 1.2701 0.0000 13143684.54 13143684.54 0.00 523072.15 523072.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.42 73.96% 230605.83 158100 591833 231653.24 174422 371147 6552709 6552709 0.00
crit 10.00 26.04% 658889.33 462284 1730518 661120.60 0 1592090 6590975 6590975 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 41166 1.9% 43.1 9.07sec 287531 0 Direct 43.1 194510 556481 287523 25.7%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.05 43.05 0.00 0.00 0.0000 0.0000 12379620.97 12379620.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.99 74.30% 194509.72 132804 497139 194894.19 145371 324305 6222338 6222338 0.00
crit 11.06 25.70% 556480.68 388319 1453635 557594.41 407735 1205993 6157283 6157283 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45603 (66914) 2.1% (3.1%) 3.0 120.36sec 6675889 0 Direct 94.4 116064 236771 143912 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.36 94.36 0.00 0.0000 0.6134 13579156.34 13579156.34 0.00 344283.41 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.59 76.93% 116064.33 116064 116064 116064.33 116064 116064 8425531 8425531 0.00
crit 21.77 23.07% 236771.23 236771 236771 236771.23 236771 236771 5153625 5153625 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21311 1.0% 37.7 6.95sec 168251 0 Direct 37.7 135409 276235 168249 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.72 37.72 0.00 0.00 0.0000 0.0000 6346246.26 6346246.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.92 76.68% 135409.19 135409 135409 135409.19 135409 135409 3916379 3916379 0.00
crit 8.80 23.32% 276234.76 276235 276235 276234.76 276235 276235 2429867 2429867 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 135571 / 86979
Fire Blast 135571 4.0% 96.8 2.98sec 268459 138045 Direct 96.8 215539 431111 268454 24.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.76 96.76 0.00 0.00 1.9447 0.0000 25976613.46 25976613.46 0.00 138044.98 138044.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.01 75.45% 215539.42 203949 231353 215597.06 209983 222970 15736079 15736079 0.00
crit 23.75 24.55% 431110.83 407899 462707 431204.69 417339 449691 10240534 10240534 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 180052 / 24413
Lightning Blast 180052 1.1% 37.7 7.48sec 194516 197408 Direct 37.7 158437 317182 194512 22.7%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.66 37.66 0.00 0.00 0.9854 0.0000 7325401.87 7325401.87 0.00 197407.62 197407.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.10 77.27% 158437.47 151074 171373 158485.92 152538 168311 4610548 4610548 0.00
crit 8.56 22.73% 317182.46 302147 342746 317207.99 0 342746 2714854 2714854 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
3ilevel
Ascendance 2.0 181.92sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 106.46sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.46 0.00 0.00 0.00 1.0432 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:3ilevel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.14sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8311 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5061 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 14.69% 0.0(0.0) 2.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.0sec 32.13% 32.13% 3.1(3.1) 8.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.5 1.3 29.9sec 25.9sec 31.37% 31.37% 1.3(1.3) 9.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.5 1.3 29.7sec 25.8sec 31.31% 31.31% 1.3(1.3) 9.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.6sec 25.6sec 30.57% 30.57% 1.6(1.6) 9.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 75.7 34.6 4.0sec 2.7sec 77.48% 71.89% 34.6(34.6) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.79%
  • elemental_focus_2:57.69%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.21% 19.21% 0.0(0.0) 4.7

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 23.4 6.8 12.3sec 9.5sec 25.50% 42.23% 6.9(6.9) 1.3

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.50%

Trigger Attempt Success

  • trigger_pct:99.84%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.67% 29.67% 4.2(4.2) 12.6

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 84.8sec 84.8sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.88%
Potion of Prolonged Power 2.0 0.0 91.0sec 0.0sec 39.89% 39.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.0 2.3 47.3sec 32.8sec 31.17% 38.57% 2.3(5.6) 2.2

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.97%
  • power_of_the_maelstrom_2:7.29%
  • power_of_the_maelstrom_3:17.91%

Trigger Attempt Success

  • trigger_pct:14.86%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 4.9 0.0 46.4sec 46.4sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.01%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.9sec 62.2sec 11.79% 9.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.30%
  • stormkeeper_2:3.79%
  • stormkeeper_3:3.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:3ilevel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 30.3 9.5sec
Lava Surge: Wasted 7.0 31.4sec
Lava Surge: During Lava Burst 4.2 54.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6000.00117.03916.0070.00020.273
Fire Elemental0.5080.0011.7630.6260.0003.585
Ascendance2.1000.0019.2131.8890.0009.213
Lava Burst3.0000.00137.52644.8696.97693.368
Elemental Blast2.1490.00120.26736.22619.24065.527

Resources

Resource Usage Type Count Total Average RPE APR
3ilevel
earth_shock Maelstrom 73.5 8726.6 118.7 918.2 2263.7
earthquake Maelstrom 373.0 18649.9 50.0 386.8 11733.9
flame_shock Maelstrom 203.5 3850.6 18.9 146.4 13887.8
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 430.08 5107.45 (16.17%) 11.88 53.55 1.04%
Lava Burst Overload Maelstrom 273.49 2397.13 (7.59%) 8.77 64.24 2.61%
Lava Beam Maelstrom 58.06 1629.39 (5.16%) 28.06 42.52 2.54%
Lava Beam Overload Maelstrom 85.91 1610.50 (5.10%) 18.75 78.22 4.63%
Chain Lightning Maelstrom 323.61 7575.70 (23.98%) 23.41 133.56 1.73%
Chain Lightning Overload Maelstrom 394.27 6643.98 (21.03%) 16.85 373.11 5.32%
Lightning Bolt Maelstrom 297.20 2368.92 (7.50%) 7.97 8.69 0.37%
Lightning Bolt Overload Maelstrom 333.08 1979.58 (6.27%) 5.94 18.92 0.95%
Resonance Totem Maelstrom 2310.40 2280.89 (7.22%) 0.99 29.51 1.28%
Resource RPS-Gain RPS-Loss
Maelstrom 13.61 13.45
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 45.55 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data 3ilevel Fight Length
Count 5810
Mean 300.02
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 35.3835
5th Percentile 245.56
95th Percentile 354.42
( 95th Percentile - 5th Percentile ) 108.86
Mean Distribution
Standard Deviation 0.4642
95.00% Confidence Intervall ( 299.11 - 300.93 )
Normalized 95.00% Confidence Intervall ( 99.70% - 100.30% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 535
0.1% Error 53433
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1069
DPS
Sample Data 3ilevel Damage Per Second
Count 5810
Mean 2173102.96
Minimum 1844700.58
Maximum 2612327.76
Spread ( max - min ) 767627.18
Range [ ( max - min ) / 2 * 100% ] 17.66%
Standard Deviation 101298.0996
5th Percentile 2011529.53
95th Percentile 2340807.46
( 95th Percentile - 5th Percentile ) 329277.93
Mean Distribution
Standard Deviation 1328.9640
95.00% Confidence Intervall ( 2170498.24 - 2175707.68 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 84
0.1% Error 8348
0.1 Scale Factor Error with Delta=300 87596402
0.05 Scale Factor Error with Delta=300 350385605
0.01 Scale Factor Error with Delta=300 8759640119
Priority Target DPS
Sample Data 3ilevel Priority Target Damage Per Second
Count 5810
Mean 1063077.12
Minimum 894468.42
Maximum 1218743.57
Spread ( max - min ) 324275.16
Range [ ( max - min ) / 2 * 100% ] 15.25%
Standard Deviation 42253.9094
5th Percentile 995613.54
95th Percentile 1135261.27
( 95th Percentile - 5th Percentile ) 139647.72
Mean Distribution
Standard Deviation 554.3433
95.00% Confidence Intervall ( 1061990.62 - 1064163.61 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 61
0.1% Error 6069
0.1 Scale Factor Error with Delta=300 15241141
0.05 Scale Factor Error with Delta=300 60964562
0.01 Scale Factor Error with Delta=300 1524114039
DPS(e)
Sample Data 3ilevel Damage Per Second (Effective)
Count 5810
Mean 2173102.96
Minimum 1844700.58
Maximum 2612327.76
Spread ( max - min ) 767627.18
Range [ ( max - min ) / 2 * 100% ] 17.66%
Damage
Sample Data 3ilevel Damage
Count 5810
Mean 617588186.71
Minimum 449982510.76
Maximum 828161673.23
Spread ( max - min ) 378179162.47
Range [ ( max - min ) / 2 * 100% ] 30.62%
DTPS
Sample Data 3ilevel Damage Taken Per Second
Count 5810
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data 3ilevel Healing Per Second
Count 5810
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data 3ilevel Healing Per Second (Effective)
Count 5810
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data 3ilevel Heal
Count 5810
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data 3ilevel Healing Taken Per Second
Count 5810
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data 3ilevel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data 3ilevelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data 3ilevel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.03 totem_mastery,if=buff.resonance_totem.remains<2
9 3.46 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.10 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.92 stormkeeper
G 0.18 ascendance
0.00 liquid_magma_totem
H 1.98 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 48.21 earthquake
J 1.59 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.65 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.50 lava_beam
M 34.72 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.82 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.04 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.80 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.39 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.46 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.26 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.16 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 54.18 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.25 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.68 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.01 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 13.38 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 7.77 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 23.56 lightning_bolt
e 0.16 flame_shock,moving=1,target_if=refreshable
f 0.36 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdWddPWWTWWWSILLIILAIIILMWWSXXbbbdTWbXWXXSWWMIIMMIIMMSWWXXdWdWTdSWdQWFMIMIAIMIIH97JHKWWbWWXXXWbSWIIMMIIMMWSW8TAbbWWXXXWSdWWIMFIMMAIIMMSWWdWTddJIJKMJIMIMIMIIMOMKWWXXbcccc9RSWWPWIILFILAIIISVVWWWTWbXXbSWWWWIMIMIMIIMQS8WWAXXcWcWWcSWTWMMIMFIAIMIQSWWddddccTWSXQWMIMIIM9IMSWW

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation 3ilevel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.062 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.062 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.880 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.967 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.004 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.042 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.822 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.601 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.378 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.158 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.934 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.934 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, ascendance, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.969 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom bloodlust, ascendance, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.005 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.784 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.821 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.857 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.944 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.048 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.824 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.861 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.898 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.677 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.455 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.492 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.492 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.272 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.035 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.798 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.814 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.832 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:26.849 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:27.914 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:29.109 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:29.909 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:30.710 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:31.776 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:32.842 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.930 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:35.017 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:35.833 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:36.921 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.988 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.785 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.585 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.386 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.185 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:42.569 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:43.610 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:45.021 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:46.433 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.492 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.552 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.962 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.374 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.433 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.493 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.906 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.318 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.729 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.789 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.201 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.260 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.320 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.703 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.741 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.125 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:07.508 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.567 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.978 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.387 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.447 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.505 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom movement, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.564 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.975 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.035 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.096 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.157 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.217 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.277 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.277 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.338 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.397 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.457 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.495 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.534 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:27.573 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:27.573 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.612 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.651 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:31.035 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.444 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.503 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:34.916 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:35.975 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:37.385 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:38.446 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.506 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.566 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.626 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:43.036 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:44.418 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:45.456 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:46.494 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:47.533 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:48.914 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.326 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.387 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.447 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.858 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.268 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.328 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.825 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.235 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.990 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.048 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.048 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.458 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.869 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.928 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.340 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.398 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.456 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.517 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.576 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:11.960 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:13.004 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom movement, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:13.997 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:15.317 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:16.310 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:17.631 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:18.621 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:19.612 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom lava_surge, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:20.603 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:21.615 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:21.615 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:22.626 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:23.665 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:24.703 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:26.087 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:27.472 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:28.792 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.137 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.483 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.494 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.505 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.851 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:36.197 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:37.208 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:38.218 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:39.279 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:40.876 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:42.195 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:43.187 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:44.178 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:45.498 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:46.489 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:47.809 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.800 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.148 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.157 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.217 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.276 aoe O flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom movement, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.336 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.747 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.158 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.503 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.851 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.843 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.835 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.156 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.475 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.795 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.117 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.439 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.477 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.517 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.929 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.989 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.335 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.335 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.682 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.692 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.701 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.048 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.057 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.069 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.416 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom ascendance, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:22.416 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom ascendance, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.474 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom ascendance, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:24.534 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:25.594 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom ascendance, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:26.975 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom ascendance, elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:27.968 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom ascendance, elemental_blast_haste, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.960 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom ascendance, lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:29.953 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:31.274 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:32.267 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.278 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.623 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:35.969 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:36.981 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.041 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.453 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:40.863 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:41.873 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:43.220 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:44.230 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:45.239 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:46.250 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:47.595 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:48.605 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.951 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:50.961 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:52.371 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.431 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.490 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.900 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:56.939 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:58.321 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:59.075 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.112 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.497 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.497 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.556 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.615 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.027 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.086 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.498 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.557 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.968 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.378 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.788 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.799 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.808 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.820 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.167 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.513 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.524 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.870 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.881 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.892 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:22.892 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:23.882 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:24.921 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.960 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:26.997 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:28.380 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:29.763 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:31.084 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:32.075 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:33.066 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:34.387 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:35.734 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:37.081 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:38.425 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:39.436 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:40.847 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:42.259 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:43.320 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:44.380 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:45.441 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:46.853 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:47.892 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:49.276 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:50.315 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:51.356 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:52.738 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.798 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.857 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.269 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.679 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:59.061 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84818 84818 44295
Intellect 60171 57940 47856 (23864)
Spirit 0 0 0
Health 5089080 5089080 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60171 57940 0
Crit 20.33% 20.33% 6133
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.79% 58.79% 7253
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 957, weapon: { 4465 - 8293, 2.6 }, stats: { +1582 Int, +2373 Sta, +445 Crit, +428 Mastery, +20134 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 957, stats: { +2076 Int, +3115 Sta, +585 Crit, +561 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="3ilevel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:7:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,ilevel=957
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.88
# gear_stamina=44295
# gear_intellect=47856
# gear_crit_rating=6133
# gear_haste_rating=11779
# gear_mastery_rating=7253
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

baseline : 2078479 dps, 1015033 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2078478.6 2078478.6 2492.8 / 0.120% 374295.3 / 18.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 2078479
Chain Lightning 187408 (408309) 9.1% (19.7%) 41.8 6.40sec 2934212 2247595 Direct 166.2 240800 656899 339040 23.6%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.84 166.19 0.00 0.00 1.3055 0.0000 56341540.90 56341540.90 0.00 2247595.15 2247595.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 126.95 76.39% 240800.01 149101 548492 241435.00 161944 294055 30570610 30570610 0.00
crit 39.23 23.61% 656899.10 412712 1518225 659071.78 445322 1016653 25770931 25770931 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 220901 10.7% 51.1 9.50sec 1299366 0 Direct 227.7 207859 565131 291706 23.5%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.11 227.71 0.00 0.00 0.0000 0.0000 66415363.21 66415363.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.27 76.53% 207859.06 125245 460733 208150.06 136258 299717 36220385 36220385 0.00
crit 53.44 23.47% 565131.33 346678 1275309 566760.45 372700 908114 30194978 30194978 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 62947 3.0% 9.5 31.50sec 1986883 2017810 Direct 9.5 1369630 3796123 1986659 25.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.50 9.50 0.00 0.00 0.9848 0.0000 18882670.20 18882670.20 0.00 2017810.45 2017810.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.09 74.56% 1369630.37 110908 1587850 1371770.49 533520 1550089 9705530 9705530 0.00
crit 2.42 25.44% 3796123.40 315421 4395169 3543867.07 0 4395169 9177140 9177140 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (700350) 0.0% (33.7%) 48.2 5.82sec 4351732 4313091

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.24 0.00 0.00 0.00 1.0090 0.0000 0.00 0.00 0.00 4313090.57 4313090.57
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 512462 24.7% 286.2 0.97sec 536662 0 Direct 1465.0 75099 207890 104843 22.4%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.20 1465.01 0.00 0.00 0.0000 0.0000 153593980.56 153593980.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1136.88 77.60% 75098.61 67421 82673 75125.56 72613 78658 85378337 85378337 0.00
crit 328.13 22.40% 207890.28 186622 228839 207960.90 198823 217833 68215643 68215643 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 187888 9.0% 73.4 4.36sec 767476 0 Direct 73.4 549606 1521204 767484 22.4%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.39 73.39 0.00 0.00 0.0000 0.0000 56328450.58 56328450.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.94 77.58% 549606.27 527760 588317 549714.14 534791 573362 31292780 31292780 0.00
crit 16.46 22.42% 1521203.88 1460840 1628463 1521503.57 1460840 1610043 25035671 25035671 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 56727 (86751) 2.7% (4.2%) 19.9 15.28sec 1305050 962828 Direct 19.9 592920 1643309 853503 24.8%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.93 19.93 0.00 0.00 1.3555 0.0000 17008363.55 17008363.55 0.00 962828.11 962828.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.98 75.19% 592920.17 528062 647519 593031.40 561531 622525 8883725 8883725 0.00
crit 4.94 24.81% 1643309.43 1461674 1792333 1637056.80 0 1792333 8124639 8124639 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30024 1.4% 12.6 23.25sec 715443 0 Direct 12.6 498100 1380232 715423 24.6%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.58 12.58 0.00 0.00 0.0000 0.0000 8997623.67 8997623.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.48 75.36% 498100.08 443572 543916 498154.49 454012 535303 4720759 4720759 0.00
crit 3.10 24.64% 1380231.99 1227806 1505559 1333103.90 0 1505559 4276864 4276864 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 167314 8.0% 26.3 11.46sec 1902120 1923102 Direct 26.3 87616 248271 206465 74.0%  
Periodic 302.4 47831 184255 147524 73.1% 133.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.31 26.31 302.40 302.40 0.9891 1.3233 50044874.18 50044874.18 0.00 117420.55 1923101.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.84 26.01% 87616.14 78852 96690 87501.73 0 92862 599659 599659 0.00
crit 19.47 73.99% 248270.65 218264 267638 248118.57 232710 258926 4832824 4832824 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.4 26.92% 47831.07 35 53181 47815.71 43685 50285 3894225 3894225 0.00
crit 221.0 73.08% 184255.48 85 206085 184180.80 169077 193079 40718166 40718166 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast6
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14504 0.7% 5.1 60.35sec 849953 0 Periodic 48.0 73498 149606 90754 22.7% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.99 47.99 0.0000 1.2509 4354968.90 4354968.90 0.00 72551.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.1 77.33% 73498.04 114 76542 73488.43 69688 76542 2727415 2727415 0.00
crit 10.9 22.67% 149606.07 237 156146 149588.54 54305 156146 1627554 1627554 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 59150 (132822) 2.8% (6.3%) 7.5 28.85sec 5241063 4348305 Direct 35.9 350774 965792 486871 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.50 35.95 0.00 0.00 1.2054 0.0000 17499412.81 17499412.81 0.00 4348304.53 4348304.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.99 77.87% 350773.54 172248 890988 351621.07 219626 513097 9818886 9818886 0.00
crit 7.95 22.13% 965792.36 476784 2466254 963515.20 0 2038226 7680526 7680526 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 73673 3.5% 11.0 41.01sec 1972700 0 Direct 54.3 288315 802265 401545 22.0%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.04 54.26 0.00 0.00 0.0000 0.0000 21787518.65 21787518.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.31 77.97% 288315.06 144687 748424 288798.41 170394 557489 12196427 12196427 0.00
crit 11.96 22.03% 802265.43 400495 2071637 803359.67 0 2071637 9591092 9591092 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast5
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 151233 (247690) 7.3% (11.9%) 55.6 5.36sec 1332348 1130597 Direct 55.6 255842 813517 813496 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.61 55.61 0.00 0.00 1.1785 0.0000 45238468.12 45238468.12 0.00 1130596.96 1130596.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 255841.93 229983 270845 535.98 0 270845 536 536 0.00
crit 55.61 100.00% 813517.19 701650 1108186 814103.75 782317 854093 45237932 45237932 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77824 3.7% 35.4 8.35sec 657047 0 Direct 35.4 214643 657061 657050 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.44 35.44 0.00 0.00 0.0000 0.0000 23282853.52 23282853.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 214642.60 193186 227509 187.36 0 227509 187 187 0.00
crit 35.43 100.00% 657060.59 566884 895336 657536.48 621900 718067 23282666 23282666 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18633 0.9% 41.4 6.70sec 134462 0 Direct 95.1 46727 95255 58579 24.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.42 95.09 0.00 0.00 0.0000 0.0000 5570089.14 5570089.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.86 75.58% 46726.54 44808 49948 46724.66 44917 49581 3357859 3357859 0.00
crit 23.22 24.42% 95255.28 91408 101895 95251.87 0 100902 2212230 2212230 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 41665 (81387) 2.0% (3.9%) 38.4 7.53sec 637916 502181 Direct 38.4 226394 612224 326586 26.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.37 38.37 0.00 0.00 1.2703 0.0000 12531843.03 12531843.03 0.00 502180.51 502180.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.40 74.03% 226394.02 156284 574916 227302.37 170366 406730 6430504 6430504 0.00
crit 9.96 25.97% 612223.62 432595 1591368 614306.09 432595 1284554 6101339 6101339 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 39722 1.9% 43.4 8.96sec 275404 0 Direct 43.4 191028 516749 275426 25.9%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.37 43.37 0.00 0.00 0.0000 0.0000 11943932.87 11943932.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.13 74.10% 191027.66 131279 482929 191396.80 140220 322454 6138934 6138934 0.00
crit 11.23 25.90% 516749.44 363380 1336749 517110.91 377278 1252075 5804999 5804999 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45624 (66951) 2.2% (3.2%) 3.0 120.33sec 6676720 0 Direct 94.4 116064 236771 143932 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 94.38 94.38 0.00 0.0000 0.6130 13584109.72 13584109.72 0.00 344502.85 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.59 76.91% 116064.33 116064 116064 116064.33 116064 116064 8425200 8425200 0.00
crit 21.79 23.09% 236771.23 236771 236771 236771.23 236771 236771 5158909 5158909 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21327 1.0% 37.8 6.91sec 167789 0 Direct 37.8 135409 276235 167794 23.0%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.83 37.83 0.00 0.00 0.0000 0.0000 6348136.23 6348136.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.14 77.01% 135409.19 135409 135409 135409.19 135409 135409 3945164 3945164 0.00
crit 8.70 22.99% 276234.76 276235 276235 276234.76 276235 276235 2402972 2402972 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 133168 / 85520
Fire Blast 133168 4.1% 96.9 2.98sec 263611 135572 Direct 96.9 211819 423650 263617 24.4%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.89 96.89 0.00 0.00 1.9445 0.0000 25540607.80 25540607.80 0.00 135571.62 135571.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.20 75.55% 211819.42 201607 224741 211877.75 206966 217833 15504980 15504980 0.00
crit 23.69 24.45% 423649.83 403214 449481 423742.73 409443 440160 10035628 10035628 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 176416 / 23932
Lightning Blast 176416 1.2% 37.7 7.48sec 190511 193409 Direct 37.7 155648 311473 190513 22.4%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.68 37.68 0.00 0.00 0.9850 0.0000 7177985.13 7177985.13 0.00 193408.92 193408.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.25 77.63% 155647.56 149339 166474 155693.81 150751 163491 4552414 4552414 0.00
crit 8.43 22.37% 311473.14 298677 332949 311559.31 298677 332949 2625572 2625572 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
baseline
Ascendance 2.0 181.96sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 106.63sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.46 0.00 0.00 0.00 1.0431 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.19sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8307 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5061 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 14.73% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.1sec 32.09% 32.09% 3.1(3.1) 8.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.5 1.3 29.7sec 25.8sec 31.38% 31.38% 1.3(1.3) 9.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.5sec 25.6sec 31.57% 31.57% 1.3(1.3) 9.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.57%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.2 1.6 30.6sec 25.7sec 30.40% 30.40% 1.6(1.6) 8.9

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 75.7 34.5 4.0sec 2.7sec 77.49% 71.85% 34.5(34.5) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.82%
  • elemental_focus_2:57.67%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.0sec 60.0sec 19.22% 19.22% 0.0(0.0) 4.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 23.4 6.8 12.3sec 9.5sec 25.38% 42.06% 6.8(6.8) 1.3

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.38%

Trigger Attempt Success

  • trigger_pct:99.86%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.82% 29.82% 4.3(4.3) 12.6

Buff details

  • buff initial source:baseline
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.8sec 85.8sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.19%
Potion of Prolonged Power 2.0 0.0 91.0sec 0.0sec 39.90% 39.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.1 2.3 46.9sec 32.5sec 31.54% 39.31% 2.3(5.7) 2.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.99%
  • power_of_the_maelstrom_2:7.44%
  • power_of_the_maelstrom_3:18.11%

Trigger Attempt Success

  • trigger_pct:15.10%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.0 0.0 45.9sec 45.9sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.17%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.9sec 62.2sec 11.78% 9.74% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.30%
  • stormkeeper_2:3.79%
  • stormkeeper_3:3.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 30.2 9.5sec
Lava Surge: Wasted 6.9 31.7sec
Lava Surge: During Lava Burst 4.3 53.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.6030.00117.39616.0480.11919.876
Fire Elemental0.5140.0012.0090.6260.0003.383
Ascendance2.1410.0019.1581.9300.0009.158
Lava Burst2.9930.00134.39844.7126.52196.322
Elemental Blast2.1460.00119.21136.12817.95861.243

Resources

Resource Usage Type Count Total Average RPE APR
baseline
earth_shock Maelstrom 72.3 8587.8 118.8 903.6 2198.8
earthquake Maelstrom 367.0 18349.5 50.0 380.4 11440.2
flame_shock Maelstrom 200.1 3787.6 18.9 144.0 13212.7
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 423.03 5021.09 (16.16%) 11.87 55.30 1.09%
Lava Burst Overload Maelstrom 269.56 2362.64 (7.60%) 8.76 63.41 2.61%
Lava Beam Maelstrom 57.03 1598.10 (5.14%) 28.02 42.63 2.60%
Lava Beam Overload Maelstrom 84.03 1573.83 (5.06%) 18.73 77.50 4.69%
Chain Lightning Maelstrom 318.25 7448.81 (23.97%) 23.41 136.53 1.80%
Chain Lightning Overload Maelstrom 388.86 6547.96 (21.07%) 16.84 381.56 5.51%
Lightning Bolt Maelstrom 291.91 2326.67 (7.49%) 7.97 8.58 0.37%
Lightning Bolt Overload Maelstrom 329.92 1959.61 (6.30%) 5.94 19.90 1.01%
Resonance Totem Maelstrom 2271.55 2241.67 (7.21%) 0.99 29.88 1.32%
Resource RPS-Gain RPS-Loss
Maelstrom 13.62 13.46
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 45.85 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Shaman_Elemental_T20M Fight Length
Count 5728
Mean 299.98
Minimum 239.99
Maximum 359.98
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 35.3811
5th Percentile 245.39
95th Percentile 354.52
( 95th Percentile - 5th Percentile ) 109.13
Mean Distribution
Standard Deviation 0.4675
95.00% Confidence Intervall ( 299.06 - 300.89 )
Normalized 95.00% Confidence Intervall ( 99.69% - 100.31% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 535
0.1% Error 53440
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1069
DPS
Sample Data Shaman_Elemental_T20M Damage Per Second
Count 5728
Mean 2078478.57
Minimum 1768668.63
Maximum 2458010.35
Spread ( max - min ) 689341.72
Range [ ( max - min ) / 2 * 100% ] 16.58%
Standard Deviation 96257.4883
5th Percentile 1928351.57
95th Percentile 2243547.42
( 95th Percentile - 5th Percentile ) 315195.85
Mean Distribution
Standard Deviation 1271.8416
95.00% Confidence Intervall ( 2075985.80 - 2080971.33 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 83
0.1% Error 8239
0.1 Scale Factor Error with Delta=300 79095672
0.05 Scale Factor Error with Delta=300 316382688
0.01 Scale Factor Error with Delta=300 7909567184
Priority Target DPS
Sample Data Shaman_Elemental_T20M Priority Target Damage Per Second
Count 5728
Mean 1015032.61
Minimum 887754.51
Maximum 1151506.93
Spread ( max - min ) 263752.43
Range [ ( max - min ) / 2 * 100% ] 12.99%
Standard Deviation 38826.7356
5th Percentile 952598.76
95th Percentile 1078876.23
( 95th Percentile - 5th Percentile ) 126277.47
Mean Distribution
Standard Deviation 513.0142
95.00% Confidence Intervall ( 1014027.12 - 1016038.09 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5621
0.1 Scale Factor Error with Delta=300 12869019
0.05 Scale Factor Error with Delta=300 51476075
0.01 Scale Factor Error with Delta=300 1286901851
DPS(e)
Sample Data Shaman_Elemental_T20M Damage Per Second (Effective)
Count 5728
Mean 2078478.57
Minimum 1768668.63
Maximum 2458010.35
Spread ( max - min ) 689341.72
Range [ ( max - min ) / 2 * 100% ] 16.58%
Damage
Sample Data Shaman_Elemental_T20M Damage
Count 5728
Mean 589754199.84
Minimum 415268310.52
Maximum 781225453.62
Spread ( max - min ) 365957143.10
Range [ ( max - min ) / 2 * 100% ] 31.03%
DTPS
Sample Data Shaman_Elemental_T20M Damage Taken Per Second
Count 5728
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Shaman_Elemental_T20M Healing Per Second
Count 5728
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Shaman_Elemental_T20M Healing Per Second (Effective)
Count 5728
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Shaman_Elemental_T20M Heal
Count 5728
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Shaman_Elemental_T20M Healing Taken Per Second
Count 5728
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Shaman_Elemental_T20M Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Shaman_Elemental_T20MTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Shaman_Elemental_T20M Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.99 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.00 totem_mastery,if=buff.resonance_totem.remains<2
9 3.41 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.99 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.87 stormkeeper
G 0.18 ascendance
0.00 liquid_magma_totem
H 1.91 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 47.56 earthquake
J 1.56 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.65 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.39 lava_beam
M 34.27 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.15 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.79 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 5.96 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.78 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.11 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.39 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.25 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.16 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 53.45 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.06 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.64 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.01 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 13.40 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 7.64 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 22.92 lightning_bolt
e 0.16 flame_shock,moving=1,target_if=refreshable
f 0.34 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddPWWWTWWWILLIIILAILMISWWXXdddWdXWXXScWYbMIMIMIIMMSWWXXdddWWTSWbQWFMIMIMAIMISWWX97bWbIIMKIMIMIMIIMMIIMKM8IMAMMIMMIKQWWfdMFIMIAIMIMIKMIWWddQccSTWcIIMMIIMIRSWWXXHMMIIMGJSWWWILFILAIILSVWWWYbQbWWSXddW9IMIIIMIMQ8SWWAXXddWdWWSWbIIMIFIAIMISQVVWWbbWIIMJIKMMIIIMIMIMJIKMM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.878 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:02.966 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.053 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.138 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.954 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.771 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.587 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.403 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.403 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.490 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.577 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.664 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.482 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.299 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.387 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.473 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.289 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.377 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.463 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.281 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.097 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.914 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.000 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.000 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.817 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.902 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.988 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.805 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.893 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.979 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.067 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.884 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.701 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.788 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.876 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.962 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.778 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:35.864 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:36.682 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:37.767 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:38.583 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:39.399 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:40.487 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:41.573 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:42.612 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:43.651 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:45.035 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:46.418 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:47.455 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.869 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.928 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.339 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.399 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.458 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.870 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.254 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:57.638 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:58.629 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
0:59.949 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:00.940 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.950 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.298 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.644 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.990 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.337 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.348 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.407 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.045 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.104 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.516 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.573 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:15.612 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.652 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:17.689 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:18.727 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:19.766 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:20.803 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:21.864 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:21.864 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:22.902 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:24.285 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:25.323 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:26.705 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:27.743 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.155 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.214 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.273 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.273 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.684 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.744 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.156 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:36.216 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:37.277 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:38.687 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.113 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.124 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:42.470 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:43.481 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:44.802 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:45.796 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:47.118 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:48.109 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:49.100 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:50.422 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.833 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.894 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.955 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.367 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.778 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.190 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.944 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.954 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.300 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.300 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.647 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.994 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.986 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:06.307 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:07.629 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.669 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:10.158 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.218 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:12.628 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.689 single_asc f earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom movement, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.748 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:16.130 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:17.515 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:18.556 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:19.594 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:20.631 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:21.671 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:21.671 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.709 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:23.750 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:24.788 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:25.825 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:26.861 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:28.273 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:29.685 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:30.744 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:32.156 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.569 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:34.980 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:36.392 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:37.452 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:38.863 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:40.274 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:41.685 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:42.745 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:44.156 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:45.569 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:46.628 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.687 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.097 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.508 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.567 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.624 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.033 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.094 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.155 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.566 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:58.604 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.988 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.026 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.063 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.100 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.512 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.924 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.982 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.040 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.451 aoe G ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.451 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.511 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.922 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.335 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.682 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.029 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.040 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.387 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.561 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.571 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.916 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.916 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.927 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom ascendance, lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.987 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom ascendance, lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.398 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.808 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.868 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.927 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.310 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.349 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.386 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.769 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.807 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:36.191 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:37.575 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:38.612 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:40.189 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:41.229 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:42.612 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:43.995 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:45.378 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:46.416 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:47.455 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:48.839 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.898 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:50.959 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:52.018 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.428 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.487 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.901 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.961 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.715 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.127 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.474 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.821 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.821 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.830 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.838 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.183 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.530 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.541 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.888 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.898 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.310 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:12.723 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.782 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.193 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.252 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.310 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.724 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:19.782 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.842 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:21.901 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:21.901 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:22.959 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:24.019 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:25.077 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:26.490 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.502 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.511 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.522 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.869 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.216 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:33.563 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.911 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:35.921 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:36.932 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:37.971 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:39.355 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:40.392 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:41.431 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:42.814 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:44.198 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:45.582 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:46.620 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.680 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.741 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.153 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.213 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.623 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.682 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.095 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.156 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.215 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.627 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.972 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 81584 81584 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 4895040 4895040 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="baseline"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

ctt_nature : 2118177 dps, 1030513 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2118177.4 2118177.4 2538.8 / 0.120% 391500.3 / 18.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ctt_nature 2118177
Chain Lightning 194944 (425179) 9.2% (20.1%) 42.0 6.39sec 3043201 2331092 Direct 166.8 249949 678693 351403 23.7%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.01 166.79 0.00 0.00 1.3055 0.0000 58610693.83 58610693.83 0.00 2331091.67 2331091.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.32 76.34% 249948.85 153402 575037 250566.66 166976 311139 31825256 31825256 0.00
crit 39.46 23.66% 678693.13 424617 1591703 680710.62 460291 964125 26785438 26785438 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 230234 10.9% 51.3 9.49sec 1350395 0 Direct 228.3 215705 588278 303284 23.5%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.27 228.30 0.00 0.00 0.0000 0.0000 69240359.99 69240359.99 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.63 76.49% 215704.60 128858 483031 215952.96 140181 331451 37667305 37667305 0.00
crit 53.67 23.51% 588278.27 356679 1337031 589775.11 382180 976493 31573055 31573055 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Heavy_Spear1
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 65045 3.1% 9.5 31.72sec 2056828 2087777 Direct 9.5 1417003 3922282 2056726 25.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.50 9.50 0.00 0.00 0.9852 0.0000 19531151.25 19531151.25 0.00 2087776.72 2087776.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.07 74.46% 1417002.50 117240 1664698 1419010.85 933983 1601405 10018851 10018851 0.00
crit 2.43 25.54% 3922281.64 308037 4607884 3641793.83 0 4607884 9512300 9512300 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (712138) 0.0% (33.6%) 48.3 5.81sec 4416113 4374917

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.34 0.00 0.00 0.00 1.0094 0.0000 0.00 0.00 0.00 4374917.28 4374917.28
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 517096 24.4% 286.8 0.97sec 540386 0 Direct 1468.1 75615 209309 105582 22.4%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.84 1468.06 0.00 0.00 0.0000 0.0000 155003284.71 155003284.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1138.99 77.58% 75614.77 67421 84244 75643.50 72372 80076 86124833 86124833 0.00
crit 329.07 22.42% 209308.96 186622 233188 209392.10 200436 223207 68878452 68878452 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 195042 9.2% 73.5 4.34sec 795376 0 Direct 73.5 569268 1575312 795360 22.5%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.54 73.54 0.00 0.00 0.0000 0.0000 58488303.71 58488303.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.01 77.53% 569267.77 542984 616791 569385.76 550448 595334 32453276 32453276 0.00
crit 16.53 22.47% 1575312.19 1502979 1707276 1575757.36 1508081 1681739 26035028 26035028 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast2
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 58799 (89813) 2.8% (4.2%) 19.9 15.28sec 1351329 996847 Direct 19.9 613950 1701644 884862 24.9%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.94 19.94 0.00 0.00 1.3556 0.0000 17640728.79 17640728.79 0.00 996847.14 996847.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.97 75.09% 613949.59 543294 678857 614101.49 585693 653914 9190804 9190804 0.00
crit 4.97 24.91% 1701643.65 1503838 1879077 1695305.19 0 1879077 8449925 8449925 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 31014 1.5% 12.6 23.03sec 737190 0 Direct 12.6 515712 1429185 737206 24.2%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.61 12.61 0.00 0.00 0.0000 0.0000 9299065.25 9299065.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.56 75.75% 515712.05 456367 570240 515859.07 466437 557327 4927941 4927941 0.00
crit 3.06 24.25% 1429185.22 1263224 1578425 1379279.85 0 1578425 4371125 4371125 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 168122 7.9% 26.2 11.41sec 1919976 1942006 Direct 26.2 88206 249904 208082 74.1%  
Periodic 301.6 48138 185596 148645 73.1% 133.0%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.19 26.19 301.61 301.61 0.9887 1.3231 50282414.61 50282414.61 0.00 118322.98 1942005.82
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.77 25.87% 88206.10 78852 98528 88091.01 0 95976 597543 597543 0.00
crit 19.41 74.13% 249903.84 218264 272724 249738.58 234803 263132 4851772 4851772 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.1 26.88% 48137.97 31 54191 48124.53 43814 50771 3902769 3902769 0.00
crit 220.5 73.12% 185595.77 98 210001 185505.87 170956 196172 40930331 40930331 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14502 0.7% 5.1 60.36sec 847860 0 Periodic 48.0 73520 149524 90731 22.6% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.14 0.00 48.00 48.00 0.0000 1.2511 4354799.01 4354799.01 0.00 72526.80 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.1 77.35% 73520.35 228 76542 73509.08 69833 76542 2729418 2729418 0.00
crit 10.9 22.65% 149523.71 237 156146 149489.90 92309 156146 1625381 1625381 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 59775 (133900) 2.8% (6.2%) 7.5 28.62sec 5277244 4377587 Direct 36.0 353129 974665 490750 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.51 36.02 0.00 0.00 1.2055 0.0000 17676856.03 17676856.03 0.00 4377587.03 4377587.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.05 77.86% 353129.27 172248 908617 353783.08 219008 573444 9902674 9902674 0.00
crit 7.98 22.14% 974665.14 476784 2515052 974582.83 522716 2230353 7774182 7774182 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 74125 3.5% 11.0 41.05sec 2002863 0 Direct 53.8 292440 812441 407759 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.96 53.84 0.00 0.00 0.0000 0.0000 21953439.33 21953439.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.90 77.82% 292440.22 144687 763232 293257.92 180634 588694 12252861 12252861 0.00
crit 11.94 22.18% 812440.53 400495 2112627 813560.22 0 2016599 9700579 9700579 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 151948 (248470) 7.2% (11.7%) 55.5 5.32sec 1339336 1136634 Direct 55.5 255675 819142 819101 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.51 55.51 0.00 0.00 1.1783 0.0000 45466576.33 45466576.33 0.00 1136633.53 1136633.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 255674.53 229983 276204 1039.68 0 276204 1040 1040 0.00
crit 55.50 99.99% 819141.93 701650 1129245 819737.61 783260 864017 45465537 45465537 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77884 3.7% 35.2 8.31sec 661465 0 Direct 35.2 214615 661509 661466 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.24 35.24 0.00 0.00 0.0000 0.0000 23307159.60 23307159.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 214614.57 193186 232011 727.26 0 232011 727 727 0.00
crit 35.23 99.99% 661508.82 566884 912350 662006.50 621916 712966 23306432 23306432 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18638 0.9% 41.2 6.54sec 135118 0 Direct 94.6 47021 95865 58904 24.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.22 94.56 0.00 0.00 0.0000 0.0000 5570053.09 5570053.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.56 75.68% 47020.90 44808 50897 47027.57 44878 50295 3364950 3364950 0.00
crit 23.00 24.32% 95865.49 91408 103831 95907.81 91408 102992 2205103 2205103 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 43066 (83873) 2.0% (4.0%) 38.3 7.64sec 659380 518926 Direct 38.3 234009 636450 338601 26.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.27 38.27 0.00 0.00 1.2707 0.0000 12958104.08 12958104.08 0.00 518926.31 518926.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.32 74.01% 234008.66 160793 602740 235112.61 176047 409079 6628266 6628266 0.00
crit 9.95 25.99% 636450.17 445074 1668385 638276.97 0 1468744 6329839 6329839 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 40807 1.9% 43.2 9.08sec 284435 0 Direct 43.2 197269 535366 284439 25.8%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.16 43.16 0.00 0.00 0.0000 0.0000 12276763.67 12276763.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.03 74.22% 197268.68 135066 506302 197554.34 147520 349594 6319117 6319117 0.00
crit 11.13 25.78% 535366.09 373862 1401444 536760.36 383209 1180511 5957646 5957646 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45708 (67102) 2.1% (3.1%) 3.0 120.35sec 6687022 0 Direct 94.6 116064 236771 143876 23.0%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 94.58 94.58 0.00 0.0000 0.6133 13607216.56 13607216.56 0.00 344334.75 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.79 76.96% 116064.33 116064 116064 116064.33 116064 116064 8448075 8448075 0.00
crit 21.79 23.04% 236771.23 236771 236771 236771.23 236771 236771 5159142 5159142 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21394 1.0% 37.9 6.97sec 168002 0 Direct 37.9 135409 276235 168008 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.90 37.90 0.00 0.00 0.0000 0.0000 6366609.03 6366609.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.13 76.86% 135409.19 135409 135409 135409.19 135409 135409 3943821 3943821 0.00
crit 8.77 23.14% 276234.76 276235 276235 276234.76 276235 276235 2422788 2422788 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 133924 / 85881
Fire Blast 133924 4.0% 96.8 2.99sec 265089 136343 Direct 96.8 213215 426314 265095 24.3%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.75 96.75 0.00 0.00 1.9443 0.0000 25647594.09 25647594.09 0.00 136342.87 136342.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.20 75.66% 213215.02 201607 229011 213272.56 207634 222204 15607049 15607049 0.00
crit 23.55 24.34% 426313.62 403214 458023 426417.64 411430 446600 10040545 10040545 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 177701 / 24154
Lightning Blast 177701 1.1% 37.8 7.50sec 191973 194808 Direct 37.8 156727 313593 191976 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.75 37.75 0.00 0.00 0.9855 0.0000 7247036.49 7247036.49 0.00 194807.57 194807.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.27 77.53% 156727.36 149339 169638 156765.29 150475 166176 4587272 4587272 0.00
crit 8.48 22.47% 313592.65 298677 339276 313714.22 0 339276 2659764 2659764 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ctt_nature
Ascendance 2.0 181.99sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 107.15sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.46 0.00 0.00 0.00 1.0427 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ctt_nature
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.19sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.17 0.00 0.00 0.00 0.8317 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.03 0.00 0.00 0.00 0.5057 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 14.74% 0.0(0.0) 2.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 25.1sec 32.10% 32.10% 3.1(3.1) 8.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.8sec 25.9sec 31.43% 31.43% 1.3(1.3) 9.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.5 1.3 29.6sec 25.7sec 31.42% 31.42% 1.3(1.3) 9.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.5sec 25.6sec 30.59% 30.59% 1.6(1.6) 9.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 75.7 34.7 4.0sec 2.7sec 77.55% 71.95% 34.7(34.7) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.80%
  • elemental_focus_2:57.75%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.0sec 60.0sec 19.15% 19.15% 0.0(0.0) 4.7

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 23.4 6.7 12.4sec 9.5sec 25.40% 42.00% 6.8(6.8) 1.3

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.40%

Trigger Attempt Success

  • trigger_pct:99.86%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.75% 29.75% 4.2(4.2) 12.6

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.1sec 85.1sec 0.36% 0.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.36%

Trigger Attempt Success

  • trigger_pct:78.38%
Potion of Prolonged Power 2.0 0.0 91.0sec 0.0sec 39.88% 39.88% 0.0(0.0) 2.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.0 2.3 47.1sec 32.7sec 31.34% 39.10% 2.3(5.6) 2.2

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.06%
  • power_of_the_maelstrom_2:7.26%
  • power_of_the_maelstrom_3:18.02%

Trigger Attempt Success

  • trigger_pct:14.96%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 4.9 0.0 46.1sec 46.1sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:9.99%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.9sec 62.2sec 11.83% 9.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.32%
  • stormkeeper_2:3.82%
  • stormkeeper_3:3.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.09% 2.0(2.0) 0.0

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:ctt_nature
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 30.2 9.5sec
Lava Surge: Wasted 6.9 31.9sec
Lava Surge: During Lava Burst 4.2 54.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.5660.00117.26316.0970.00219.852
Fire Elemental0.5060.0011.9140.6190.0003.261
Ascendance2.1660.00110.0721.9470.00010.072
Lava Burst3.0140.00133.05744.8576.705101.889
Elemental Blast2.1400.00120.29736.11918.69770.536

Resources

Resource Usage Type Count Total Average RPE APR
ctt_nature
earth_shock Maelstrom 74.2 8809.5 118.7 927.7 2217.0
earthquake Maelstrom 377.9 18896.0 50.0 390.9 11298.3
flame_shock Maelstrom 204.7 3874.6 18.9 147.9 12977.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 433.95 5151.53 (16.13%) 11.87 55.85 1.07%
Lava Burst Overload Maelstrom 275.49 2414.79 (7.56%) 8.77 64.59 2.61%
Lava Beam Maelstrom 58.71 1648.53 (5.16%) 28.08 41.07 2.43%
Lava Beam Overload Maelstrom 85.68 1605.32 (5.03%) 18.74 77.99 4.63%
Chain Lightning Maelstrom 328.43 7684.80 (24.06%) 23.40 138.43 1.77%
Chain Lightning Overload Maelstrom 400.83 6747.43 (21.12%) 16.83 391.49 5.48%
Lightning Bolt Maelstrom 299.16 2384.16 (7.46%) 7.97 9.09 0.38%
Lightning Bolt Overload Maelstrom 337.40 2004.75 (6.28%) 5.94 19.66 0.97%
Resonance Totem Maelstrom 2334.58 2304.35 (7.21%) 0.99 30.24 1.30%
Resource RPS-Gain RPS-Loss
Maelstrom 13.62 13.46
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 48.67 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ctt_nature Fight Length
Count 5902
Mean 300.02
Minimum 239.96
Maximum 360.04
Spread ( max - min ) 120.08
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.1402
5th Percentile 246.63
95th Percentile 353.41
( 95th Percentile - 5th Percentile ) 106.79
Mean Distribution
Standard Deviation 0.4574
95.00% Confidence Intervall ( 299.12 - 300.91 )
Normalized 95.00% Confidence Intervall ( 99.70% - 100.30% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 528
0.1% Error 52701
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1055
DPS
Sample Data ctt_nature Damage Per Second
Count 5902
Mean 2118177.44
Minimum 1804878.40
Maximum 2495213.19
Spread ( max - min ) 690334.78
Range [ ( max - min ) / 2 * 100% ] 16.30%
Standard Deviation 99512.0370
5th Percentile 1963866.23
95th Percentile 2289935.56
( 95th Percentile - 5th Percentile ) 326069.33
Mean Distribution
Standard Deviation 1295.3168
95.00% Confidence Intervall ( 2115638.67 - 2120716.22 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 85
0.1% Error 8479
0.1 Scale Factor Error with Delta=300 84534678
0.05 Scale Factor Error with Delta=300 338138711
0.01 Scale Factor Error with Delta=300 8453467766
Priority Target DPS
Sample Data ctt_nature Priority Target Damage Per Second
Count 5902
Mean 1030513.46
Minimum 890925.13
Maximum 1201357.06
Spread ( max - min ) 310431.93
Range [ ( max - min ) / 2 * 100% ] 15.06%
Standard Deviation 39324.2786
5th Percentile 968599.90
95th Percentile 1098207.31
( 95th Percentile - 5th Percentile ) 129607.41
Mean Distribution
Standard Deviation 511.8717
95.00% Confidence Intervall ( 1029510.21 - 1031516.71 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 56
0.1% Error 5594
0.1 Scale Factor Error with Delta=300 13200951
0.05 Scale Factor Error with Delta=300 52803802
0.01 Scale Factor Error with Delta=300 1320095032
DPS(e)
Sample Data ctt_nature Damage Per Second (Effective)
Count 5902
Mean 2118177.44
Minimum 1804878.40
Maximum 2495213.19
Spread ( max - min ) 690334.78
Range [ ( max - min ) / 2 * 100% ] 16.30%
Damage
Sample Data ctt_nature Damage
Count 5902
Mean 601633578.87
Minimum 425858692.17
Maximum 796909898.56
Spread ( max - min ) 371051206.38
Range [ ( max - min ) / 2 * 100% ] 30.84%
DTPS
Sample Data ctt_nature Damage Taken Per Second
Count 5902
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ctt_nature Healing Per Second
Count 5902
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ctt_nature Healing Per Second (Effective)
Count 5902
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ctt_nature Heal
Count 5902
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ctt_nature Healing Taken Per Second
Count 5902
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ctt_nature Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ctt_natureTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ctt_nature Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.02 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.06 totem_mastery,if=buff.resonance_totem.remains<2
9 3.51 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.25 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 4.01 stormkeeper
G 0.19 ascendance
0.00 liquid_magma_totem
H 1.98 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 49.11 earthquake
J 1.59 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.72 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.63 lava_beam
M 35.40 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.15 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.84 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.11 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.82 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.65 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.60 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.24 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.17 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 54.98 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.44 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.67 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.01 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 13.76 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 7.95 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 23.66 lightning_bolt
e 0.17 flame_shock,moving=1,target_if=refreshable
f 0.37 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddPWWWWTWWSLIIILLAIIMMWWXSXbbbWTWWWWXXXcSWIMIIIMMIMWSWcXccWTcWWSWQbFIMIMIAMIMSWWXbW97dWYbSHMHMMIMIIMIMMHH8KMAMIMHMIJJWSfbMFIMIMAIIMSWWXbbdTWXbSbXWbIMMIMIIMSWWRXXXbWWPWSWWTWLIFLI9ALISVWWWbYbbcQSWcWTMMIIMMIIMS8WWbAbYbccQSWddIMIMFMIAIMMSWWWTbbbWdQSddWYMMIIMIMISWdW

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ctt_nature 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.878 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.944 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.960 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.976 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.738 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.501 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.265 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.044 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.044 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.082 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.118 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.897 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.934 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.0/125: 98% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.715 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.751 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.835 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.026 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.114 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, ascendance, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.930 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom bloodlust, ascendance, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.747 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, ascendance, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.565 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, ascendance, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.651 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, ascendance, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.737 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.737 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.555 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.371 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.459 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.547 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.632 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.720 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.537 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.624 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.442 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.531 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.617 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.706 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.522 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:35.338 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.139 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.204 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.003 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.802 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.601 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.399 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.198 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:42.608 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:44.021 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:45.079 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:46.139 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.550 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.609 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.669 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.728 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.141 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.200 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom movement, lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.260 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.670 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.729 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.140 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.484 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.831 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.841 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.187 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.535 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.882 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.892 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.238 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.299 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.357 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.768 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.178 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.237 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.645 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:16.684 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:17.722 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:18.761 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:19.800 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.839 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.896 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.896 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.955 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:24.014 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:25.425 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:26.836 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:27.896 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.308 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.368 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:31.778 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:32.816 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:33.855 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:33.855 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:35.241 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:36.623 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:37.662 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.073 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.485 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.496 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:42.843 aoe H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:43.854 aoe M chain_lightning Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:45.199 aoe M chain_lightning Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:46.520 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:47.513 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:48.836 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:49.828 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:50.819 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.230 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.289 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.701 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.111 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:57.149 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.188 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.942 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.324 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.708 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.708 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.053 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.064 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.410 aoe H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.420 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.767 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.778 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.788 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.798 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.210 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.379 single_asc f earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom movement, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.438 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:15.850 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.261 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:18.320 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.379 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.438 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.496 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.535 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.535 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:23.574 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:24.610 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:25.650 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:27.034 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:28.072 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:29.453 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.513 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.923 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:33.333 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:34.744 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:35.804 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:37.214 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:38.253 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:39.637 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:41.021 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:42.341 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:43.333 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:44.654 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:45.974 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:46.964 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.284 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.604 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.614 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.960 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.019 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.078 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.491 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.903 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.314 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.725 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.784 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.844 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.903 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.961 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.373 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.433 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.847 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.044 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.456 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.867 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom ascendance, lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.928 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom ascendance, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.340 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.399 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom ascendance, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.809 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom ascendance, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.220 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom ascendance, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.280 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom ascendance, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.376 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom ascendance, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.789 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom ascendance, lava_surge, elemental_blast_mastery, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.847 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom ascendance, lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.906 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom ascendance, lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.906 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom ascendance, lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.316 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.374 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.787 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.846 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.858 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.203 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.549 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.896 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.906 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.252 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:36.572 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:37.892 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:38.930 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:40.314 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.660 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:43.008 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:44.021 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:45.032 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:46.379 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:47.726 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:48.736 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.748 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.094 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:52.505 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.565 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.624 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.036 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.447 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:58.201 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:59.521 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.842 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.161 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.161 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:03.482 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:04.472 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:05.793 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.141 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.489 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.550 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.962 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.375 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.721 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.068 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.079 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:17.398 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:18.389 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:19.710 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:20.699 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:21.690 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.750 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:22.750 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:23.789 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:24.828 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.867 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:27.252 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:28.244 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.591 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.599 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.610 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.955 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.302 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:35.649 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:36.997 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:38.343 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:39.404 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:40.813 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:42.222 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:43.569 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:44.914 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:45.924 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:47.271 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.618 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.628 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.637 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.984 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.044 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.457 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.516 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.928 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.340 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.750 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ctt_nature"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:7:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

ea_es : 2099276 dps, 1028114 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2099275.8 2099275.8 2516.0 / 0.120% 396136.1 / 18.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ea_es 2099276
Chain Lightning 189120 (411547) 9.0% (19.7%) 42.1 6.40sec 2941081 2252171 Direct 166.9 241982 660244 340791 23.6%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.08 166.85 0.00 0.00 1.3059 0.0000 56862409.13 56862409.13 0.00 2252171.16 2252171.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.43 76.38% 241982.25 149101 558915 242655.20 163879 304166 30836749 30836749 0.00
crit 39.42 23.62% 660243.93 412712 1547076 661960.27 449449 936853 26025660 26025660 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 222427 10.6% 51.3 9.55sec 1302821 0 Direct 228.3 208713 568977 293017 23.4%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.34 228.28 0.00 0.00 0.0000 0.0000 66887639.81 66887639.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.87 76.60% 208712.58 125245 469488 208961.59 135048 315913 36496286 36496286 0.00
crit 53.41 23.40% 568976.81 346678 1299544 570228.34 375681 925414 30391354 30391354 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 70032 3.3% 9.5 31.14sec 2203975 2238223 Direct 9.5 1520658 4206096 2203937 25.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.54 9.54 0.00 0.00 0.9847 0.0000 21021392.98 21021392.98 0.00 2238223.27 2238223.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.11 74.55% 1520657.53 125741 1785406 1523414.84 893885 1785406 10813455 10813455 0.00
crit 2.43 25.45% 4206095.59 330373 4942003 3921683.67 0 4942003 10207938 10207938 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (705052) 0.0% (33.6%) 48.3 5.86sec 4378077 4337548

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.27 0.00 0.00 0.00 1.0093 0.0000 0.00 0.00 0.00 4337547.61 4337547.61
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 516422 24.6% 286.3 0.98sec 540633 0 Direct 1465.7 75611 209304 105609 22.4%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.31 1465.69 0.00 0.00 0.0000 0.0000 154789945.95 154789945.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1136.82 77.56% 75610.95 67421 84244 75641.80 72118 80564 85955432 85955432 0.00
crit 328.88 22.44% 209304.07 186622 233188 209386.01 200767 223644 68834514 68834514 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 188630 9.0% 73.2 4.37sec 772283 0 Direct 73.2 553275 1531175 772289 22.4%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.20 73.20 0.00 0.00 0.0000 0.0000 56531035.88 56531035.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.81 77.60% 553275.09 527760 599497 553424.54 533836 579777 31429480 31429480 0.00
crit 16.39 22.40% 1531175.27 1460840 1659409 1531741.72 1460840 1637345 25101555 25101555 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Heavy_Spear2
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57299 (87632) 2.7% (4.2%) 19.9 15.29sec 1318129 972392 Direct 19.9 596577 1653772 861690 25.1%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.94 19.94 0.00 0.00 1.3556 0.0000 17181010.18 17181010.18 0.00 972391.52 972391.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.94 74.92% 596576.62 528062 659824 596715.96 565857 631010 8911312 8911312 0.00
crit 5.00 25.08% 1653772.32 1461674 1826393 1649903.32 0 1826393 8269698 8269698 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30333 1.4% 12.6 23.14sec 722752 0 Direct 12.6 501323 1389354 722664 24.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.59 12.59 0.00 0.00 0.0000 0.0000 9099815.34 9099815.34 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.45 75.07% 501323.39 443572 554252 501489.81 458357 554252 4738070 4738070 0.00
crit 3.14 24.93% 1389354.50 1227806 1534170 1338986.20 0 1534170 4361745 4361745 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 168182 8.0% 26.2 11.40sec 1920136 1940912 Direct 26.2 88221 249899 208166 74.2%  
Periodic 301.6 48148 185528 148694 73.2% 133.1%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.20 26.20 301.64 301.64 0.9893 1.3233 50306498.94 50306498.94 0.00 118342.06 1940912.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.76 25.81% 88220.64 78852 98528 88101.30 0 95465 596582 596582 0.00
crit 19.44 74.19% 249898.66 218264 272724 249724.49 234313 263635 4857281 4857281 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.9 26.81% 48147.90 34 54191 48130.83 43681 51201 3893796 3893796 0.00
crit 220.8 73.19% 185527.80 93 210001 185436.86 172436 196289 40958840 40958840 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14517 0.7% 5.1 60.37sec 850771 0 Periodic 48.0 73496 149565 90817 22.8% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 48.00 48.00 0.0000 1.2509 4358970.71 4358970.71 0.00 72599.90 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.1 77.23% 73496.46 116 76542 73485.33 70425 76542 2724422 2724422 0.00
crit 10.9 22.77% 149565.24 465 156146 149575.14 113399 156146 1634549 1634549 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 59631 (134899) 2.8% (6.3%) 7.5 29.03sec 5334242 4424889 Direct 35.9 353798 978965 491444 22.0%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.48 35.88 0.00 0.00 1.2056 0.0000 17633553.51 17633553.51 0.00 4424889.22 4424889.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.98 77.98% 353798.30 172248 908617 354444.19 218603 537554 9899947 9899947 0.00
crit 7.90 22.02% 978964.62 476784 2515052 978246.72 0 2303594 7733607 7733607 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 75268 3.5% 11.1 40.84sec 2007014 0 Direct 54.5 293468 811797 408541 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.10 54.51 0.00 0.00 0.0000 0.0000 22270097.50 22270097.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.41 77.80% 293468.48 144687 763232 293711.38 172835 588135 12443789 12443789 0.00
crit 12.10 22.20% 811797.40 400495 2112627 815481.47 0 1969005 9826308 9826308 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 152020 (248726) 7.2% (11.8%) 55.5 5.30sec 1340051 1136934 Direct 55.5 253316 819070 819039 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.52 55.52 0.00 0.00 1.1787 0.0000 45473425.57 45473425.57 0.00 1136934.43 1136934.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 253315.83 229983 276204 785.54 0 276204 786 786 0.00
crit 55.52 99.99% 819070.12 701650 1129245 819628.10 781594 873554 45472640 45472640 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 78001 3.7% 35.3 8.23sec 661384 0 Direct 35.3 221170 661400 661379 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.28 35.28 0.00 0.00 0.0000 0.0000 23335849.92 23335849.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 221169.75 212504 232011 360.98 0 232011 361 361 0.00
crit 35.28 100.00% 661399.82 566884 912350 661859.11 625408 712344 23335489 23335489 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18705 0.9% 41.3 6.57sec 135328 0 Direct 94.8 47030 95862 58949 24.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.31 94.84 0.00 0.00 0.0000 0.0000 5590576.71 5590576.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.69 75.59% 47029.78 44808 50897 47027.61 44936 50189 3371702 3371702 0.00
crit 23.15 24.41% 95861.76 91408 103831 95878.75 91408 103831 2218875 2218875 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 41897 (81606) 2.0% (3.9%) 38.2 7.61sec 642215 505813 Direct 38.2 227762 619156 329735 26.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.23 38.23 0.00 0.00 1.2697 0.0000 12605228.84 12605228.84 0.00 505812.92 505812.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.27 73.95% 227761.69 156284 585841 228835.79 173099 396215 6438202 6438202 0.00
crit 9.96 26.05% 619156.26 432595 1621608 620197.99 447015 1621608 6167027 6167027 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 39709 1.9% 43.1 9.02sec 276949 0 Direct 43.1 192236 521233 276918 25.7%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.13 43.13 0.00 0.00 0.0000 0.0000 11943895.28 11943895.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.02 74.26% 192236.09 131279 492107 192641.08 140984 331216 6156695 6156695 0.00
crit 11.10 25.74% 521232.68 363380 1362151 521899.40 0 1362151 5787201 5787201 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45575 (66897) 2.2% (3.2%) 3.0 120.33sec 6678319 0 Direct 94.3 116064 236771 143878 23.0%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.32 94.32 0.00 0.0000 0.6131 13571123.16 13571123.16 0.00 344423.06 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.59 76.96% 116064.33 116064 116064 116064.33 116064 116064 8425300 8425300 0.00
crit 21.73 23.04% 236771.23 236771 236771 236771.23 236771 236771 5145823 5145823 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21322 1.0% 37.8 6.92sec 167826 0 Direct 37.8 135409 276235 167824 23.0%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.82 37.82 0.00 0.00 0.0000 0.0000 6347206.88 6347206.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.11 76.98% 135409.19 135409 135409 135409.19 135409 135409 3942337 3942337 0.00
crit 8.71 23.02% 276234.76 276235 276235 276234.76 276235 276235 2404870 2404870 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134025 / 86077
Fire Blast 134025 4.1% 96.9 2.98sec 265370 136464 Direct 96.9 213225 426440 265368 24.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.88 96.88 0.00 0.00 1.9446 0.0000 25708532.43 25708532.43 0.00 136464.42 136464.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.18 75.54% 213225.38 201607 229011 213282.69 208342 221432 15604855 15604855 0.00
crit 23.69 24.46% 426439.58 403214 458023 426538.58 411588 445041 10103677 10103677 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 177732 / 24109
Lightning Blast 177732 1.2% 37.7 7.50sec 191983 194832 Direct 37.7 156699 313496 191986 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.68 37.68 0.00 0.00 0.9854 0.0000 7232950.16 7232950.16 0.00 194832.19 194832.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.20 77.50% 156699.07 149339 169638 156746.55 150986 166319 4575176 4575176 0.00
crit 8.48 22.50% 313495.51 298677 339276 313572.31 0 339276 2657774 2657774 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ea_es
Ascendance 2.0 182.02sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 106.41sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.46 0.00 0.00 0.00 1.0431 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ea_es
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.25sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8313 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5064 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 14.70% 0.0(0.0) 2.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 13.53% 0.0(0.0) 1.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 24.9sec 32.16% 32.16% 3.1(3.1) 8.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.6 1.3 29.7sec 25.8sec 31.50% 31.50% 1.3(1.3) 9.2

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.50%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.5 1.3 29.7sec 25.7sec 31.44% 31.44% 1.3(1.3) 9.2

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.2 1.6 30.6sec 25.7sec 30.51% 30.51% 1.6(1.6) 8.9

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.51%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 75.7 34.6 4.0sec 2.7sec 77.51% 71.92% 34.6(34.6) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.77%
  • elemental_focus_2:57.74%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.19% 19.19% 0.0(0.0) 4.7

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 23.3 6.8 12.4sec 9.5sec 25.35% 41.98% 6.9(6.9) 1.3

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.35%

Trigger Attempt Success

  • trigger_pct:99.84%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.0sec 17.1sec 29.81% 29.81% 4.2(4.2) 12.6

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.8sec 85.8sec 0.36% 0.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.36%

Trigger Attempt Success

  • trigger_pct:79.39%
Potion of Prolonged Power 2.0 0.0 91.1sec 0.0sec 39.90% 39.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.0 2.3 47.2sec 32.8sec 31.29% 39.22% 2.3(5.6) 2.1

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.96%
  • power_of_the_maelstrom_2:7.32%
  • power_of_the_maelstrom_3:18.00%

Trigger Attempt Success

  • trigger_pct:14.98%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.0 0.0 45.8sec 45.8sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.12%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.9sec 62.2sec 11.78% 9.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.30%
  • stormkeeper_2:3.79%
  • stormkeeper_3:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.12% 2.0(2.0) 0.0

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:ea_es
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 30.2 9.5sec
Lava Surge: Wasted 6.9 31.8sec
Lava Surge: During Lava Burst 4.3 54.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.5890.00117.29816.0580.09220.223
Fire Elemental0.5070.0011.8160.6200.0003.617
Ascendance2.0900.0019.2071.8670.0009.207
Lava Burst3.0020.00135.99444.59613.375102.219
Elemental Blast2.1340.00120.37135.95917.51562.101

Resources

Resource Usage Type Count Total Average RPE APR
ea_es
earth_shock Maelstrom 73.6 8737.7 118.7 916.1 2405.8
earthquake Maelstrom 372.5 18624.0 50.0 385.8 11346.7
flame_shock Maelstrom 202.1 3825.5 18.9 146.0 13150.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 428.43 5086.13 (16.12%) 11.87 55.08 1.07%
Lava Burst Overload Maelstrom 272.28 2386.86 (7.57%) 8.77 63.66 2.60%
Lava Beam Maelstrom 57.72 1617.57 (5.13%) 28.02 43.76 2.63%
Lava Beam Overload Maelstrom 85.61 1604.15 (5.08%) 18.74 78.15 4.65%
Chain Lightning Maelstrom 324.74 7587.07 (24.05%) 23.36 139.23 1.80%
Chain Lightning Overload Maelstrom 396.23 6663.31 (21.12%) 16.82 383.85 5.45%
Lightning Bolt Maelstrom 294.98 2351.04 (7.45%) 7.97 8.82 0.37%
Lightning Bolt Overload Maelstrom 332.76 1977.12 (6.27%) 5.94 19.44 0.97%
Resonance Totem Maelstrom 2304.51 2274.30 (7.21%) 0.99 30.21 1.31%
Resource RPS-Gain RPS-Loss
Maelstrom 13.63 13.47
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 47.47 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ea_es Fight Length
Count 6127
Mean 300.01
Minimum 239.92
Maximum 360.05
Spread ( max - min ) 120.13
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 35.6329
5th Percentile 244.84
95th Percentile 355.12
( 95th Percentile - 5th Percentile ) 110.28
Mean Distribution
Standard Deviation 0.4552
95.00% Confidence Intervall ( 299.11 - 300.90 )
Normalized 95.00% Confidence Intervall ( 99.70% - 100.30% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 542
0.1% Error 54192
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 44
0.01 Scale Factor Error with Delta=300 1084
DPS
Sample Data ea_es Damage Per Second
Count 6127
Mean 2099275.79
Minimum 1742444.09
Maximum 2482901.65
Spread ( max - min ) 740457.56
Range [ ( max - min ) / 2 * 100% ] 17.64%
Standard Deviation 100480.4939
5th Percentile 1939131.13
95th Percentile 2270986.35
( 95th Percentile - 5th Percentile ) 331855.22
Mean Distribution
Standard Deviation 1283.6831
95.00% Confidence Intervall ( 2096759.82 - 2101791.77 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 89
0.1% Error 8801
0.1 Scale Factor Error with Delta=300 86188077
0.05 Scale Factor Error with Delta=300 344752308
0.01 Scale Factor Error with Delta=300 8618807695
Priority Target DPS
Sample Data ea_es Priority Target Damage Per Second
Count 6127
Mean 1028113.68
Minimum 877601.52
Maximum 1185253.62
Spread ( max - min ) 307652.10
Range [ ( max - min ) / 2 * 100% ] 14.96%
Standard Deviation 40503.3486
5th Percentile 964849.46
95th Percentile 1096812.80
( 95th Percentile - 5th Percentile ) 131963.34
Mean Distribution
Standard Deviation 517.4483
95.00% Confidence Intervall ( 1027099.50 - 1029127.86 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5963
0.1 Scale Factor Error with Delta=300 14004433
0.05 Scale Factor Error with Delta=300 56017732
0.01 Scale Factor Error with Delta=300 1400443294
DPS(e)
Sample Data ea_es Damage Per Second (Effective)
Count 6127
Mean 2099275.79
Minimum 1742444.09
Maximum 2482901.65
Spread ( max - min ) 740457.56
Range [ ( max - min ) / 2 * 100% ] 17.64%
Damage
Sample Data ea_es Damage
Count 6127
Mean 595809676.27
Minimum 413751454.14
Maximum 800023987.50
Spread ( max - min ) 386272533.35
Range [ ( max - min ) / 2 * 100% ] 32.42%
DTPS
Sample Data ea_es Damage Taken Per Second
Count 6127
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ea_es Healing Per Second
Count 6127
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ea_es Healing Per Second (Effective)
Count 6127
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ea_es Heal
Count 6127
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ea_es Healing Taken Per Second
Count 6127
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ea_es Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ea_esTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ea_es Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.05 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.14 totem_mastery,if=buff.resonance_totem.remains<2
9 3.65 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.55 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 4.14 stormkeeper
G 0.20 ascendance
0.00 liquid_magma_totem
H 2.05 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 50.90 earthquake
J 1.65 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.77 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.89 lava_beam
M 36.72 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.91 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.39 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.91 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 19.38 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.91 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.27 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.28 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 57.09 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 17.03 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.77 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.01 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.26 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.36 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.49 lightning_bolt
e 0.17 flame_shock,moving=1,target_if=refreshable
f 0.38 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdWddPWWTWWWILIIILLAIIILSWWXXWbWbbTWXbSWXXbWbIMMIIMIMSWWXXddWWWTSWbbQFMIMIIMAIM97SWWXcdddYWXSWXdWMIMIMIMISW8XWAXccWXcSWdYdFMIIMIAMIIHJHJHSWbXbWbXcdSHIMIIIMMIWWSRccTcW9WXWPSWWILFIILAILIJKMIWWddXXXWWSWbIIMIIIMMIS8WWTcAXcccXSWdddIMIFMIMAIMSWWXddYdWWQSXWXWWIMMII9MISWWX

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ea_es 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.945 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.009 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.073 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.872 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.671 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.469 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.285 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.102 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.102 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.191 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.277 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.092 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.179 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.266 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.082 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.899 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.985 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.786 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:18.586 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.385 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.449 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.515 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.515 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.313 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.130 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.946 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.030 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.117 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.934 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.972 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.750 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.526 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.302 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.338 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.118 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.155 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.193 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:34.972 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:36.009 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:36.788 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:37.873 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.178 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.975 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.773 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.573 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:42.958 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:44.342 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:45.752 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.812 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.225 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.637 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.697 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.756 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.166 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.225 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.636 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.046 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.105 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.517 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.577 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.635 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.046 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.457 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.514 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.927 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.987 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.046 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.456 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.465 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.812 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.158 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.169 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.180 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.190 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.202 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.212 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.222 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.234 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.295 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.295 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.355 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.766 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.824 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.824 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.207 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.527 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.846 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:30.838 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:32.158 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.504 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:34.851 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:36.197 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:37.208 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:38.621 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:39.680 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:41.091 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:42.151 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:43.211 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:44.623 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:46.031 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:47.444 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.504 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.915 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.975 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.386 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.445 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.856 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.915 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.324 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.734 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.488 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.526 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.908 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.908 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.947 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.330 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.716 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.775 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.833 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.246 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.735 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:12.146 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.557 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.617 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:16.029 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:17.233 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:18.294 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.353 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.411 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.471 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.529 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.529 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.588 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.646 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.704 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.763 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.822 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.881 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.939 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.000 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.410 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.821 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.233 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:36.271 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:37.652 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:39.037 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:40.419 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:41.458 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:42.869 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:44.282 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:45.820 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:46.829 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.839 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.186 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.197 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.208 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.218 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.563 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.910 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.921 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.270 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.653 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.037 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.075 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.457 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.841 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.879 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:06.262 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:07.646 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:08.805 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.865 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.925 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.984 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.984 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.445 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom ascendance, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.792 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.803 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.812 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.157 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.169 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.180 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.190 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.534 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:22.534 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.543 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:24.955 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom ascendance, lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.016 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom ascendance, lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.075 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.487 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.498 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.508 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.856 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.203 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.550 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:35.871 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:36.861 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:37.854 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:38.846 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:39.884 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:41.268 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:42.651 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:43.690 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:45.102 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:46.162 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:47.221 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:48.633 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:49.670 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:50.707 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:51.746 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:53.128 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:54.511 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.570 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.983 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.737 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.084 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.432 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.441 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.788 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.788 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.798 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.145 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.492 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.838 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.896 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.388 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:11.708 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:13.028 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:14.349 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:15.669 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.678 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.024 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:19.035 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.172 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:21.164 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:22.202 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:23.242 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:23.242 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:24.280 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:25.318 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:26.703 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:28.088 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:29.472 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.531 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.943 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.356 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.416 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.826 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:36.884 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:38.296 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:39.354 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:40.765 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:41.778 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:42.788 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:43.797 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:44.808 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:46.128 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:47.120 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:48.441 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:49.761 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:50.751 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:51.744 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.826 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.237 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.297 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.709 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:57.769 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:59.152 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ea_es"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:7:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

ede_crit : 2150478 dps, 1052775 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2150477.6 2150477.6 2577.9 / 0.120% 408814.7 / 19.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ede_crit 2150478
Chain Lightning 193715 (422504) 9.0% (19.7%) 41.9 6.41sec 3031632 2322228 Direct 166.4 242395 698661 349931 23.6%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.90 166.44 0.00 0.00 1.3055 0.0000 58247425.92 58247425.92 0.00 2322227.58 2322227.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.21 76.43% 242395.30 149101 558915 243008.60 163044 299319 30837514 30837514 0.00
crit 39.23 23.57% 698660.92 435972 1634266 700962.95 470868 1135901 27409912 27409912 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 228789 10.7% 51.3 9.44sec 1341862 0 Direct 228.3 209048 601815 301204 23.5%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.26 228.33 0.00 0.00 0.0000 0.0000 68780744.86 68780744.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.76 76.54% 209047.80 125245 469488 209300.15 135271 322683 36535328 36535328 0.00
crit 53.58 23.46% 601815.39 366217 1372784 603236.33 398895 966055 32245417 32245417 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast2
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 65299 3.0% 9.5 31.69sec 2055115 2086711 Direct 9.5 1377371 4034126 2055022 25.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.54 9.54 0.00 0.00 0.9849 0.0000 19602563.40 19602563.40 0.00 2086711.03 2086711.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.11 74.49% 1377371.34 103593 1618024 1379462.59 0 1557618 9786230 9786230 0.00
crit 2.43 25.51% 4034126.35 333197 4731102 3739442.29 0 4731102 9816334 9816334 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (721181) 0.0% (33.6%) 48.2 5.82sec 4482369 4442080

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.23 0.00 0.00 0.00 1.0091 0.0000 0.00 0.00 0.00 4442080.05 4442080.05
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 528343 24.6% 286.2 0.97sec 553436 0 Direct 1464.6 75592 221011 108140 22.4%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.18 1464.64 0.00 0.00 0.0000 0.0000 158383834.17 158383834.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1136.84 77.62% 75591.82 67421 84244 75616.12 72545 79265 85936403 85936403 0.00
crit 327.80 22.38% 221011.11 197140 246330 221083.44 210279 231699 72447431 72447431 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 192839 9.0% 73.0 4.35sec 792020 0 Direct 73.0 553207 1617427 792035 22.4%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.00 73.00 0.00 0.00 0.0000 0.0000 57821085.86 57821085.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.62 77.56% 553206.66 527760 599497 553325.69 535665 579853 31323449 31323449 0.00
crit 16.38 22.44% 1617427.37 1543170 1752930 1617773.02 1543170 1722662 26497637 26497637 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 58543 (89627) 2.7% (4.2%) 19.9 15.28sec 1348669 994956 Direct 19.9 596760 1746136 880867 24.7%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.93 19.93 0.00 0.00 1.3555 0.0000 17558301.70 17558301.70 0.00 994956.25 994956.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.00 75.28% 596760.42 528062 659824 596905.90 564430 638119 8954178 8954178 0.00
crit 4.93 24.72% 1746136.27 1544052 1929325 1739562.60 0 1929325 8604124 8604124 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 31084 1.4% 12.6 23.41sec 740783 0 Direct 12.6 501343 1467700 740710 24.8%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.59 12.59 0.00 0.00 0.0000 0.0000 9323426.25 9323426.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.47 75.22% 501342.79 443572 554252 501480.97 461838 540578 4746422 4746422 0.00
crit 3.12 24.78% 1467700.22 1297004 1620633 1414305.59 0 1620633 4577004 4577004 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 176912 8.2% 26.2 11.29sec 2018339 2040934 Direct 26.2 88207 264002 218637 74.2%  
Periodic 301.6 48163 195954 156398 73.2% 133.0%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.21 26.21 301.61 301.61 0.9889 1.3233 52903048.84 52903048.84 0.00 124470.73 2040933.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.76 25.80% 88207.44 78852 98528 88085.77 0 95976 596471 596471 0.00
crit 19.45 74.20% 264001.93 230564 288094 263814.99 248526 278553 5134536 5134536 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.7 26.76% 48162.95 34 54191 48144.43 42840 51595 3887631 3887631 0.00
crit 220.9 73.24% 195953.69 132 221837 195854.18 180702 207067 43284411 43284411 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14539 0.7% 5.1 60.36sec 851601 0 Periodic 48.0 73502 149646 90952 22.9% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.13 0.00 47.99 47.99 0.0000 1.2509 4365366.72 4365366.72 0.00 72713.70 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.0 77.08% 73502.21 228 76542 73491.53 69641 76542 2719160 2719160 0.00
crit 11.0 22.92% 149645.81 233 156146 149653.69 113030 156146 1646207 1646207 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 61081 (137400) 2.8% (6.3%) 7.5 28.83sec 5422312 4497732 Direct 35.9 352624 1031775 502745 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.50 35.93 0.00 0.00 1.2056 0.0000 18066593.20 18066593.20 0.00 4497732.18 4497732.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.99 77.90% 352624.37 172248 908617 353407.26 218794 531335 9870658 9870658 0.00
crit 7.94 22.10% 1031774.65 503654 2656796 1030917.69 0 2212854 8195936 8195936 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 76319 3.5% 11.1 40.75sec 2040747 0 Direct 54.3 291265 851744 415513 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.06 54.33 0.00 0.00 0.0000 0.0000 22574914.75 22574914.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.28 77.83% 291265.00 144687 763232 292048.39 181718 572086 12316654 12316654 0.00
crit 12.04 22.17% 851744.11 423066 2231691 854195.52 0 1871440 10258261 10258261 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Heavy_Spear2
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 161020 (261705) 7.5% (12.2%) 55.5 5.30sec 1410114 1196294 Direct 55.5 263226 867743 867721 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.52 55.52 0.00 0.00 1.1787 0.0000 48171455.10 48171455.10 0.00 1196293.52 1196293.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 263226.31 229983 287368 543.34 0 287368 543 543 0.00
crit 55.51 100.00% 867743.49 743268 1196225 868359.19 831515 909281 48170912 48170912 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 82082 3.8% 35.2 8.30sec 696716 0 Direct 35.2 214695 696742 696725 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.25 35.25 0.00 0.00 0.0000 0.0000 24556096.71 24556096.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 214695.50 193186 241389 272.72 0 241389 273 273 0.00
crit 35.24 100.00% 696742.49 597021 960853 697258.08 650390 749269 24555824 24555824 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18603 0.9% 41.2 6.60sec 134704 0 Direct 94.2 47043 95908 58960 24.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.24 94.23 0.00 0.00 0.0000 0.0000 5555503.27 5555503.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.25 75.61% 47042.84 44808 50897 47042.48 45036 50101 3351745 3351745 0.00
crit 22.98 24.39% 95907.87 91408 103831 95917.41 91408 103831 2203759 2203759 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 43162 (84068) 2.0% (3.9%) 38.4 7.67sec 657581 517775 Direct 38.4 227827 650578 337635 26.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.44 38.44 0.00 0.00 1.2700 0.0000 12979058.04 12979058.04 0.00 517775.50 517775.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.45 74.02% 227826.88 156284 585841 228768.30 171893 372379 6482062 6482062 0.00
crit 9.99 25.98% 650578.05 456976 1712999 652767.10 472208 1295505 6496996 6496996 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 40906 1.9% 43.2 9.09sec 284440 0 Direct 43.2 191919 551696 284459 25.7%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.24 43.24 0.00 0.00 0.0000 0.0000 12298741.71 12298741.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.12 74.28% 191918.60 131279 492107 192344.10 143606 331367 6163540 6163540 0.00
crit 11.12 25.72% 551696.05 383859 1438919 553272.84 0 1438919 6135201 6135201 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45671 (67043) 2.1% (3.1%) 3.0 120.33sec 6685879 0 Direct 94.4 116064 236771 144001 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 94.44 94.44 0.00 0.0000 0.6133 13599051.95 13599051.95 0.00 344630.59 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.58 76.85% 116064.33 116064 116064 116064.33 116064 116064 8423657 8423657 0.00
crit 21.86 23.15% 236771.23 236771 236771 236771.23 236771 236771 5175395 5175395 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21372 1.0% 37.9 6.93sec 167898 0 Direct 37.9 135409 276235 167891 23.1%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.89 37.89 0.00 0.00 0.0000 0.0000 6360917.65 6360917.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.15 76.93% 135409.19 135409 135409 135409.19 135409 135409 3946561 3946561 0.00
crit 8.74 23.07% 276234.76 276235 276235 276190.90 0 276235 2414357 2414357 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 133997 / 86062
Fire Blast 133997 4.0% 96.9 2.98sec 265299 136445 Direct 96.9 213226 426434 265304 24.4%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.88 96.88 0.00 0.00 1.9444 0.0000 25702353.55 25702353.55 0.00 136444.66 136444.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.22 75.58% 213225.52 201607 229011 213280.32 207817 220895 15611956 15611956 0.00
crit 23.66 24.42% 426433.69 403214 458023 426549.14 412112 444905 10090398 10090398 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 177892 / 24137
Lightning Blast 177892 1.1% 37.7 7.49sec 192141 195030 Direct 37.7 156703 313742 192141 22.6%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.68 37.68 0.00 0.00 0.9852 0.0000 7240676.24 7240676.24 0.00 195029.80 195029.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.18 77.43% 156703.38 149339 169638 156747.54 150657 166319 4572436 4572436 0.00
crit 8.50 22.57% 313741.65 298677 339276 313810.25 0 339276 2668240 2668240 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
ede_crit
Ascendance 2.0 181.95sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 106.47sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.46 0.00 0.00 0.00 1.0430 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ede_crit
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.19sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8309 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.66sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5061 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 14.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.4sec 25.0sec 32.18% 32.18% 3.1(3.1) 8.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.5 1.3 29.8sec 25.9sec 31.37% 31.37% 1.3(1.3) 9.2

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.5sec 25.6sec 31.61% 31.61% 1.3(1.3) 9.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.61%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.2 1.6 30.7sec 25.7sec 30.44% 30.44% 1.6(1.6) 8.9

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 75.6 34.6 4.0sec 2.7sec 77.45% 71.82% 34.6(34.6) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.80%
  • elemental_focus_2:57.65%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.0sec 60.0sec 19.19% 19.19% 0.0(0.0) 4.7

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 23.3 6.8 12.4sec 9.5sec 25.45% 42.08% 6.9(6.9) 1.3

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.45%

Trigger Attempt Success

  • trigger_pct:99.85%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.0sec 17.0sec 29.87% 29.87% 4.3(4.3) 12.6

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.3sec 85.3sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.76%
Potion of Prolonged Power 2.0 0.0 91.0sec 0.0sec 39.89% 39.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.0 2.3 47.3sec 32.8sec 31.20% 38.92% 2.3(5.5) 2.1

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.04%
  • power_of_the_maelstrom_2:7.34%
  • power_of_the_maelstrom_3:17.82%

Trigger Attempt Success

  • trigger_pct:14.91%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.0 0.0 46.2sec 46.2sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.09%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.9sec 62.2sec 11.79% 9.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.33%
  • stormkeeper_2:3.77%
  • stormkeeper_3:3.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.11% 2.0(2.0) 0.0

Buff details

  • buff initial source:ede_crit
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 30.2 9.5sec
Lava Surge: Wasted 7.0 31.5sec
Lava Surge: During Lava Burst 4.3 54.9sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.5900.00117.44216.0550.04720.489
Fire Elemental0.5090.0011.8140.6260.0003.545
Ascendance2.1050.0019.0941.8990.0009.094
Lava Burst3.0010.00135.23644.5869.474101.152
Elemental Blast2.1370.00120.97736.07719.59361.952

Resources

Resource Usage Type Count Total Average RPE APR
ede_crit
earth_shock Maelstrom 74.1 8792.5 118.7 921.8 2229.5
earthquake Maelstrom 374.6 18730.0 50.0 388.3 11543.2
flame_shock Maelstrom 203.6 3854.3 18.9 147.0 13725.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 431.13 5116.80 (16.12%) 11.87 56.71 1.10%
Lava Burst Overload Maelstrom 273.74 2399.32 (7.56%) 8.77 64.31 2.61%
Lava Beam Maelstrom 58.21 1631.13 (5.14%) 28.02 43.09 2.57%
Lava Beam Overload Maelstrom 85.90 1607.90 (5.07%) 18.72 79.59 4.72%
Chain Lightning Maelstrom 325.41 7616.45 (23.99%) 23.41 139.28 1.80%
Chain Lightning Overload Maelstrom 398.05 6709.21 (21.13%) 16.86 383.49 5.41%
Lightning Bolt Maelstrom 298.52 2378.90 (7.49%) 7.97 9.27 0.39%
Lightning Bolt Overload Maelstrom 335.81 1995.92 (6.29%) 5.94 18.94 0.94%
Resonance Totem Maelstrom 2319.03 2288.99 (7.21%) 0.99 30.03 1.30%
Resource RPS-Gain RPS-Loss
Maelstrom 13.63 13.47
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 47.78 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data ede_crit Fight Length
Count 6298
Mean 300.00
Minimum 240.03
Maximum 359.98
Spread ( max - min ) 119.95
Range [ ( max - min ) / 2 * 100% ] 19.99%
Standard Deviation 35.2512
5th Percentile 245.53
95th Percentile 354.43
( 95th Percentile - 5th Percentile ) 108.90
Mean Distribution
Standard Deviation 0.4442
95.00% Confidence Intervall ( 299.13 - 300.87 )
Normalized 95.00% Confidence Intervall ( 99.71% - 100.29% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 531
0.1% Error 53041
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1061
DPS
Sample Data ede_crit Damage Per Second
Count 6298
Mean 2150477.60
Minimum 1826778.97
Maximum 2561252.91
Spread ( max - min ) 734473.94
Range [ ( max - min ) / 2 * 100% ] 17.08%
Standard Deviation 104379.5364
5th Percentile 1987728.14
95th Percentile 2329322.25
( 95th Percentile - 5th Percentile ) 341594.11
Mean Distribution
Standard Deviation 1315.2673
95.00% Confidence Intervall ( 2147899.72 - 2153055.47 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 91
0.1% Error 9051
0.1 Scale Factor Error with Delta=300 93006735
0.05 Scale Factor Error with Delta=300 372026938
0.01 Scale Factor Error with Delta=300 9300673441
Priority Target DPS
Sample Data ede_crit Priority Target Damage Per Second
Count 6298
Mean 1052775.14
Minimum 891130.72
Maximum 1203115.67
Spread ( max - min ) 311984.95
Range [ ( max - min ) / 2 * 100% ] 14.82%
Standard Deviation 41363.1089
5th Percentile 986156.39
95th Percentile 1123314.21
( 95th Percentile - 5th Percentile ) 137157.81
Mean Distribution
Standard Deviation 521.2089
95.00% Confidence Intervall ( 1051753.58 - 1053796.69 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5930
0.1 Scale Factor Error with Delta=300 14605285
0.05 Scale Factor Error with Delta=300 58421138
0.01 Scale Factor Error with Delta=300 1460528434
DPS(e)
Sample Data ede_crit Damage Per Second (Effective)
Count 6298
Mean 2150477.60
Minimum 1826778.97
Maximum 2561252.91
Spread ( max - min ) 734473.94
Range [ ( max - min ) / 2 * 100% ] 17.08%
Damage
Sample Data ede_crit Damage
Count 6298
Mean 611148130.10
Minimum 428039822.67
Maximum 815053904.82
Spread ( max - min ) 387014082.14
Range [ ( max - min ) / 2 * 100% ] 31.66%
DTPS
Sample Data ede_crit Damage Taken Per Second
Count 6298
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ede_crit Healing Per Second
Count 6298
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ede_crit Healing Per Second (Effective)
Count 6298
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ede_crit Heal
Count 6298
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ede_crit Healing Taken Per Second
Count 6298
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ede_crit Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data ede_critTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ede_crit Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.08 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.20 totem_mastery,if=buff.resonance_totem.remains<2
9 3.75 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.79 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 4.26 stormkeeper
G 0.18 ascendance
0.00 liquid_magma_totem
H 2.15 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 52.28 earthquake
J 1.70 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.80 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 8.12 lava_beam
M 37.67 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.09 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.99 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.54 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.97 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 19.94 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 8.15 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.27 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.36 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 58.68 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 17.50 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.80 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.01 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.62 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.45 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 25.42 lightning_bolt
e 0.16 flame_shock,moving=1,target_if=refreshable
f 0.39 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddPWWWWTWWSILLIILAIIIMIJHMKMWWbbWXXXbWWcSTWMMIIIMMISWWTddddWdSdYdQWFMIIMIAIMISWWXbb997bWXXSIJMIMMIIMIIIMMSW8WAWXXWWXdWSTWddMFIIMAIMISWWVYWbebbWSXXddWIMMIIIMIRSWWWXXdddWPT9SWWWLIIFLLAIIISVWWbbQXXcWSccTMMIIMIMNISW8dXAWXdXddSWWddIIMMFIAIMISWWVVbdQdWTSdddWIMIMIIMISWWX

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation ede_crit 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.876 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:02.941 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:04.005 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.022 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:05.786 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:06.547 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:07.309 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.090 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.090 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.126 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:10.162 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.198 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:12.234 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.014 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:13.792 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:14.878 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.024 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, ascendance, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.802 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.837 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.872 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.649 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.427 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.461 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.461 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.238 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.015 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.793 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.829 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.606 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.383 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.197 aoe M chain_lightning Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.282 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.368 aoe M chain_lightning Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:30.434 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:31.232 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:32.297 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:33.361 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:34.427 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.227 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:36.043 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:36.859 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:37.676 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:38.761 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:39.848 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:40.664 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:41.750 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:43.162 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:44.223 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:45.281 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:46.692 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.104 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.162 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.221 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.281 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.695 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.107 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.166 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.578 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.638 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.048 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.108 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.520 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.932 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.343 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.754 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.166 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:08.549 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:09.957 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:11.278 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:12.268 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:13.590 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.600 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.949 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.959 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.969 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.978 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.990 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.049 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.109 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.109 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.169 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.227 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.287 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:26.697 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.708 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.053 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.063 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:31.409 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.756 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:33.004 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom movement, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.015 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:34.015 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.361 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:36.682 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:37.676 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:38.714 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:40.096 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:41.088 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:42.079 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:43.400 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:44.391 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:45.710 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:47.055 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.065 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:49.075 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:50.422 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.483 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:52.523 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:53.561 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:54.944 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:56.328 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:57.712 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.123 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.877 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.887 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.887 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.235 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.246 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.257 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.268 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.277 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.287 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.635 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.049 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.461 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.521 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.579 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.991 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.402 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.813 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:18.873 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.932 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.992 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.052 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.052 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.110 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.170 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.230 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.640 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.986 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.333 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_haste, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.343 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.352 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:32.363 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:33.373 single_asc e flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom movement, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:34.384 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:35.704 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:37.025 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:38.408 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:40.020 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:41.079 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:42.138 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:43.548 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:44.961 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:46.020 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:47.079 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:48.492 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:49.874 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:50.913 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:51.950 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.988 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.372 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.410 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.449 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.832 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.869 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.190 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.182 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.173 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.164 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.483 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.804 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.150 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.495 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.495 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.554 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.614 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.025 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.034 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom ascendance, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.381 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.727 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.072 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.084 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.096 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom ascendance, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.107 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom ascendance, elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.453 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom ascendance, elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.800 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:22.800 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.861 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:24.919 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:25.980 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.391 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_critical_strike, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.450 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.863 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.275 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:32.657 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:34.039 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:35.076 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:36.114 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:37.154 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:38.538 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:39.921 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:41.304 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:42.715 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:44.062 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:45.072 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:46.418 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:47.766 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:48.758 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:49.749 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:51.069 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:52.059 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:53.100 aoe N lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom movement, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:54.139 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:55.178 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:56.562 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:57.947 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.702 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.113 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.173 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.173 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.584 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.645 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.058 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.116 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.529 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.939 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.349 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.409 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.821 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.233 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.644 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.703 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.762 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.172 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.583 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.644 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.703 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.703 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.762 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:24.801 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.840 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:27.224 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:28.545 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:29.866 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.875 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.885 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.231 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.578 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.588 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:36.935 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:38.283 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:39.341 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:40.753 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:42.100 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:43.448 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:44.793 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:46.137 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:47.148 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.496 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.506 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.853 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.913 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.973 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.383 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.443 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.854 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:58.237 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:59.560 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="ede_crit"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:7:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

edi_cl : 2158679 dps, 1032616 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2158678.9 2158678.9 2588.1 / 0.120% 418406.9 / 19.4% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
edi_cl 2158679
Chain Lightning 213043 (463538) 9.9% (21.6%) 42.1 6.36sec 3313012 2537221 Direct 166.9 272736 742842 383850 23.6%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.07 166.88 0.00 0.00 1.3058 0.0000 64061715.90 64061715.90 0.00 2537220.63 2537220.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.44 76.37% 272736.09 167739 628779 273552.81 184323 352539 34760737 34760737 0.00
crit 39.44 23.63% 742841.61 464301 1740460 745088.61 498756 1071630 29300979 29300979 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 250495 11.6% 51.3 9.49sec 1469223 0 Direct 228.0 234871 641091 330275 23.5%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.27 228.05 0.00 0.00 0.0000 0.0000 75320499.33 75320499.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.49 76.52% 234870.52 140901 528174 235219.92 153479 343375 40984340 40984340 0.00
crit 53.56 23.48% 641090.85 390013 1461987 642729.94 418476 1021346 34336159 34336159 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast5
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 63317 2.9% 9.5 31.75sec 2000017 2031276 Direct 9.5 1378562 3817290 1999731 25.5%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.50 9.50 0.00 0.00 0.9847 0.0000 19006652.82 19006652.82 0.00 2031276.35 2031276.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.08 74.52% 1378562.02 103593 1618024 1381070.31 953058 1618024 9762602 9762602 0.00
crit 2.42 25.48% 3817289.85 315421 4478691 3536639.00 0 4478691 9244051 9244051 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (704831) 0.0% (32.7%) 48.3 5.83sec 4374509 4334073

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.30 0.00 0.00 0.00 1.0093 0.0000 0.00 0.00 0.00 4334072.77 4334072.77
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 516037 23.9% 286.5 0.97sec 539937 0 Direct 1465.2 75604 209276 105585 22.4%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.53 1465.22 0.00 0.00 0.0000 0.0000 154706091.76 154706091.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1136.58 77.57% 75604.25 67421 84244 75636.19 72685 79360 85930532 85930532 0.00
crit 328.64 22.43% 209275.68 186622 233188 209365.03 200677 219730 68775559 68775559 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 188794 8.8% 73.3 4.34sec 772537 0 Direct 73.3 553341 1531128 772510 22.4%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.26 73.26 0.00 0.00 0.0000 0.0000 56592958.08 56592958.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.83 77.58% 553340.90 527760 599497 553505.38 534489 580238 31448510 31448510 0.00
crit 16.42 22.42% 1531128.17 1460840 1659409 1531629.59 1460840 1626529 25144448 25144448 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57169 (87192) 2.7% (4.0%) 19.9 15.28sec 1311369 967479 Direct 19.9 596655 1653059 859794 24.9%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.93 19.93 0.00 0.00 1.3555 0.0000 17136901.71 17136901.71 0.00 967479.32 967479.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.97 75.10% 596655.15 528062 659824 596823.55 563727 633629 8931362 8931362 0.00
crit 4.96 24.90% 1653059.16 1461674 1826393 1646435.84 0 1826393 8205540 8205540 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30023 1.4% 12.5 23.62sec 717675 0 Direct 12.5 501244 1388548 717612 24.4%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.54 12.54 0.00 0.00 0.0000 0.0000 9002454.56 9002454.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.48 75.61% 501243.82 443572 554252 501321.93 463539 547074 4753898 4753898 0.00
crit 3.06 24.39% 1388547.68 1227806 1534170 1336507.61 0 1534170 4248556 4248556 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 167947 7.8% 26.2 11.35sec 1917901 1938906 Direct 26.2 88225 249792 208049 74.2%  
Periodic 301.5 48178 185484 148493 73.1% 133.0%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.18 26.18 301.48 301.48 0.9892 1.3235 50215733.40 50215733.40 0.00 118181.36 1938906.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.76 25.84% 88225.45 78852 98528 88081.48 0 94700 596846 596846 0.00
crit 19.42 74.16% 249791.65 218264 272724 249599.06 233913 262315 4850303 4850303 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.2 26.94% 48178.10 34 54191 48161.79 43994 51195 3912771 3912771 0.00
crit 220.3 73.06% 185484.01 100 210001 185388.37 170018 195378 40855813 40855813 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14533 0.7% 5.1 60.35sec 851950 0 Periodic 48.0 73471 149732 90928 22.9% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.99 47.99 0.0000 1.2508 4363841.66 4363841.66 0.00 72694.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.0 77.11% 73470.64 116 76542 73460.52 69131 76542 2718817 2718817 0.00
crit 11.0 22.89% 149731.98 475 156146 149669.95 108812 156146 1645025 1645025 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 67301 (150255) 3.1% (6.9%) 7.5 28.70sec 5917589 4909384 Direct 36.1 398343 1094350 552310 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.51 36.06 0.00 0.00 1.2055 0.0000 19913957.20 19913957.20 0.00 4909383.51 4909383.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.08 77.88% 398342.94 193779 1022194 399117.28 248150 589393 11185439 11185439 0.00
crit 7.98 22.12% 1094350.37 536381 2829433 1090920.42 0 2355948 8728519 8728519 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 82954 3.8% 11.0 40.79sec 2241048 0 Direct 53.8 327316 908859 456172 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.95 53.81 0.00 0.00 0.0000 0.0000 24550329.26 24550329.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.89 77.84% 327316.43 162773 858636 328154.77 203690 690266 13712178 13712178 0.00
crit 11.93 22.16% 908858.95 450557 2376706 908434.36 0 2053556 10838151 10838151 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Heavy_Spear2
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 151881 (248489) 7.0% (11.5%) 55.5 5.34sec 1339784 1136745 Direct 55.5 255778 819072 819040 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.47 55.47 0.00 0.00 1.1786 0.0000 45431546.93 45431546.93 0.00 1136744.71 1136744.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 255777.64 229983 276204 791.15 0 276204 791 791 0.00
crit 55.47 99.99% 819071.80 701650 1129245 819627.40 785393 859498 45430756 45430756 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77809 3.6% 35.2 8.43sec 661434 0 Direct 35.2 210554 661460 661440 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.18 35.18 0.00 0.00 0.0000 0.0000 23269273.48 23269273.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 210553.81 193186 232011 325.63 0 232011 326 326 0.00
crit 35.18 100.00% 661459.82 566884 912350 661907.84 626076 712661 23268948 23268948 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18799 0.9% 41.2 6.63sec 136355 0 Direct 95.2 47050 95913 58979 24.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.19 95.22 0.00 0.00 0.0000 0.0000 5616138.52 5616138.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.97 75.59% 47050.28 44808 50897 47054.08 44912 50637 3386357 3386357 0.00
crit 23.25 24.41% 95912.79 91408 103831 95922.89 0 103075 2229782 2229782 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 41734 (81526) 1.9% (3.8%) 38.3 7.62sec 640521 504100 Direct 38.3 227365 616502 327986 25.9%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.28 38.28 0.00 0.00 1.2706 0.0000 12554918.53 12554918.53 0.00 504099.63 504099.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.38 74.14% 227364.89 156284 585841 228353.91 169769 383515 6452510 6452510 0.00
crit 9.90 25.86% 616502.28 432595 1621608 618231.45 0 1621608 6102408 6102408 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 39793 1.9% 43.2 9.09sec 276968 0 Direct 43.2 191861 520191 276991 25.9%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.20 43.20 0.00 0.00 0.0000 0.0000 11964487.59 11964487.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.00 74.07% 191861.23 131279 492107 192188.53 143305 337107 6138757 6138757 0.00
crit 11.20 25.93% 520191.18 363380 1362151 520844.79 363380 1216794 5825730 5825730 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45700 (66995) 2.1% (3.1%) 3.0 120.33sec 6685427 0 Direct 94.5 116064 236771 144008 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.51 94.51 0.00 0.0000 0.6132 13610158.25 13610158.25 0.00 344258.61 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.63 76.85% 116064.33 116064 116064 116064.33 116064 116064 8430083 8430083 0.00
crit 21.88 23.15% 236771.23 236771 236771 236771.23 236771 236771 5180076 5180076 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21295 1.0% 37.8 6.90sec 167809 0 Direct 37.8 135409 276235 167805 23.0%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.79 37.79 0.00 0.00 0.0000 0.0000 6341693.82 6341693.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.10 76.99% 135409.19 135409 135409 135409.19 135409 135409 3939955 3939955 0.00
crit 8.69 23.01% 276234.76 276235 276235 276192.04 0 276235 2401739 2401739 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134016 / 85949
Fire Blast 134016 4.0% 96.7 2.98sec 265400 136489 Direct 96.7 213204 426405 265407 24.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.73 96.73 0.00 0.00 1.9445 0.0000 25672953.58 25672953.58 0.00 136488.57 136488.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.05 75.52% 213204.43 201607 229011 213258.61 207666 220257 15574612 15574612 0.00
crit 23.68 24.48% 426404.59 403214 458023 426500.54 412853 448351 10098342 10098342 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 177845 / 24106
Lightning Blast 177845 1.1% 37.7 7.49sec 192031 194925 Direct 37.7 156702 313699 192042 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.65 37.65 0.00 0.00 0.9852 0.0000 7230343.93 7230343.93 0.00 194924.75 194924.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.18 77.50% 156701.58 149339 169638 156748.05 151120 166176 4572402 4572402 0.00
crit 8.47 22.50% 313699.45 298677 339276 313789.24 298677 339276 2657942 2657942 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
edi_cl
Ascendance 2.0 181.91sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 106.72sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.45 0.00 0.00 0.00 1.0431 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:edi_cl
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.13sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8310 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.64sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5060 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 14.72% 0.0(0.0) 2.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 24.9sec 32.21% 32.21% 3.1(3.1) 8.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.5 1.3 29.8sec 25.9sec 31.39% 31.39% 1.3(1.3) 9.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.5 1.3 29.8sec 25.8sec 31.31% 31.31% 1.3(1.3) 9.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.2 1.6 30.6sec 25.6sec 30.52% 30.52% 1.6(1.6) 8.9

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 75.5 34.6 4.0sec 2.7sec 77.45% 71.83% 34.6(34.6) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.80%
  • elemental_focus_2:57.65%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.20% 19.20% 0.0(0.0) 4.7

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 23.3 6.8 12.4sec 9.5sec 25.44% 42.06% 6.8(6.8) 1.3

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.44%

Trigger Attempt Success

  • trigger_pct:99.86%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.76% 29.76% 4.3(4.3) 12.6

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.6sec 85.6sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.64%
Potion of Prolonged Power 2.0 0.0 91.0sec 0.0sec 39.88% 39.88% 0.0(0.0) 2.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.0 2.3 47.1sec 32.5sec 31.43% 39.18% 2.3(5.7) 2.2

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.89%
  • power_of_the_maelstrom_2:7.41%
  • power_of_the_maelstrom_3:18.13%

Trigger Attempt Success

  • trigger_pct:15.11%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 5.0 0.0 46.0sec 46.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.05%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.9sec 62.2sec 11.72% 9.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.28%
  • stormkeeper_2:3.77%
  • stormkeeper_3:3.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:edi_cl
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 30.1 9.5sec
Lava Surge: Wasted 6.9 31.8sec
Lava Surge: During Lava Burst 4.2 54.5sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.5920.00117.19416.0620.00020.141
Fire Elemental0.5030.0011.4600.6160.0003.562
Ascendance2.1170.0019.8921.8940.0009.892
Lava Burst3.0190.00136.91444.8537.014100.531
Elemental Blast2.1340.00120.09736.00618.12461.471

Resources

Resource Usage Type Count Total Average RPE APR
edi_cl
earth_shock Maelstrom 73.1 8684.5 118.7 913.8 2188.6
earthquake Maelstrom 371.9 18593.0 50.0 384.9 11364.5
flame_shock Maelstrom 201.6 3813.9 18.9 145.7 13166.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 426.98 5068.45 (16.11%) 11.87 55.37 1.08%
Lava Burst Overload Maelstrom 270.80 2374.67 (7.55%) 8.77 62.50 2.56%
Lava Beam Maelstrom 57.85 1624.79 (5.17%) 28.09 40.77 2.45%
Lava Beam Overload Maelstrom 84.32 1580.59 (5.02%) 18.75 76.25 4.60%
Chain Lightning Maelstrom 323.88 7570.88 (24.07%) 23.38 137.49 1.78%
Chain Lightning Overload Maelstrom 394.69 6643.28 (21.12%) 16.83 379.67 5.41%
Lightning Bolt Maelstrom 294.66 2348.28 (7.47%) 7.97 8.96 0.38%
Lightning Bolt Overload Maelstrom 332.49 1975.09 (6.28%) 5.94 19.85 0.99%
Resonance Totem Maelstrom 2298.93 2269.53 (7.22%) 0.99 29.40 1.28%
Resource RPS-Gain RPS-Loss
Maelstrom 13.62 13.46
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 46.90 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data edi_cl Fight Length
Count 6466
Mean 300.01
Minimum 239.93
Maximum 360.08
Spread ( max - min ) 120.15
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 34.9214
5th Percentile 245.89
95th Percentile 354.09
( 95th Percentile - 5th Percentile ) 108.20
Mean Distribution
Standard Deviation 0.4343
95.00% Confidence Intervall ( 299.16 - 300.87 )
Normalized 95.00% Confidence Intervall ( 99.72% - 100.28% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 521
0.1% Error 52047
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1042
DPS
Sample Data edi_cl Damage Per Second
Count 6466
Mean 2158678.90
Minimum 1757557.34
Maximum 2547130.98
Spread ( max - min ) 789573.64
Range [ ( max - min ) / 2 * 100% ] 18.29%
Standard Deviation 106180.7478
5th Percentile 1991159.66
95th Percentile 2339558.05
( 95th Percentile - 5th Percentile ) 348398.39
Mean Distribution
Standard Deviation 1320.4681
95.00% Confidence Intervall ( 2156090.83 - 2161266.97 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 93
0.1% Error 9295
0.1 Scale Factor Error with Delta=300 96244347
0.05 Scale Factor Error with Delta=300 384977386
0.01 Scale Factor Error with Delta=300 9624434642
Priority Target DPS
Sample Data edi_cl Priority Target Damage Per Second
Count 6466
Mean 1032615.90
Minimum 879301.16
Maximum 1220353.20
Spread ( max - min ) 341052.05
Range [ ( max - min ) / 2 * 100% ] 16.51%
Standard Deviation 40589.6979
5th Percentile 967858.63
95th Percentile 1099991.22
( 95th Percentile - 5th Percentile ) 132132.59
Mean Distribution
Standard Deviation 504.7752
95.00% Confidence Intervall ( 1031626.56 - 1033605.24 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5936
0.1 Scale Factor Error with Delta=300 14064209
0.05 Scale Factor Error with Delta=300 56256836
0.01 Scale Factor Error with Delta=300 1406420887
DPS(e)
Sample Data edi_cl Damage Per Second (Effective)
Count 6466
Mean 2158678.90
Minimum 1757557.34
Maximum 2547130.98
Spread ( max - min ) 789573.64
Range [ ( max - min ) / 2 * 100% ] 18.29%
Damage
Sample Data edi_cl Damage
Count 6466
Mean 613659352.79
Minimum 402592995.47
Maximum 824203970.56
Spread ( max - min ) 421610975.09
Range [ ( max - min ) / 2 * 100% ] 34.35%
DTPS
Sample Data edi_cl Damage Taken Per Second
Count 6466
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data edi_cl Healing Per Second
Count 6466
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data edi_cl Healing Per Second (Effective)
Count 6466
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data edi_cl Heal
Count 6466
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data edi_cl Healing Taken Per Second
Count 6466
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data edi_cl Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data edi_clTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data edi_cl Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.11 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.25 totem_mastery,if=buff.resonance_totem.remains<2
9 3.84 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 9.02 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 4.37 stormkeeper
G 0.19 ascendance
0.00 liquid_magma_totem
H 2.20 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 53.75 earthquake
J 1.79 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.90 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 8.36 lava_beam
M 38.80 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.09 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 2.03 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.70 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 2.00 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 20.41 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 8.30 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.28 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.42 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 60.14 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 17.96 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.88 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.01 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 15.01 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.75 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 25.92 lightning_bolt
e 0.18 flame_shock,moving=1,target_if=refreshable
f 0.39 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWVRVVWWPWWTWWWLIILILIALILISWWXXbbbdWXWWXSXWddTMMIIMIMMSWWTWWXbXbbSWbQFIMIMIAMIMSWW97WTbcXWXSXccWMIIMMIIMSWZXXWAWbbWXWSbbbTMFIMIMIAMIIJKIMWbbWbXXXSWdIMMIIMIMSHHJHMMIJHJI9GJSWWILIFILLAIISVWWXdddYWdSdddQIMMIIIMIMS8WWXXAdWdWWXSWYdWMIMIFIMAIMSTWdWdWbXbbSTWdQMIII9MMIMSWW

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation edi_cl 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.061 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.877 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.963 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.048 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.867 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.683 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.499 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.317 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.135 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.223 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.223 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.311 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.399 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.217 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.033 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.120 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.206 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.292 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.108 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.924 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.010 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.828 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.915 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.733 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.733 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.818 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:23.634 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.718 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.535 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.621 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.707 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.794 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.610 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.426 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.512 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.598 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.685 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.773 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:35.590 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:36.404 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:37.490 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:38.309 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:39.126 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:40.213 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:41.030 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:42.089 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:43.500 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:44.883 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:45.923 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:47.306 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.689 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.750 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.807 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.219 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.278 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.689 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.099 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.510 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.922 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.981 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.041 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.099 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.510 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.570 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.982 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.042 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.453 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.864 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.277 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.687 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.099 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.160 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.220 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.279 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.337 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.397 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.458 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.517 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.517 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.577 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:23.635 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:25.019 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:26.401 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:27.784 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:29.167 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:30.205 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.205 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:31.266 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:32.326 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:33.711 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:35.094 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:36.131 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:37.515 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:38.573 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.985 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.045 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:42.456 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:43.866 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:45.278 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:46.690 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.750 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.809 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.222 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.633 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.691 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.752 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.164 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.576 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.922 single_asc Z totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.676 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.686 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.697 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.045 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.045 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.056 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.403 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.749 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.759 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.819 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.230 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.640 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:12.024 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:13.345 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:14.665 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:15.657 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:16.978 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:17.969 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:18.960 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:19.952 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:20.944 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_blast_haste, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:21.936 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.976 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.976 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.036 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:25.096 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:26.156 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:27.214 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:28.625 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:29.683 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:31.095 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.507 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.918 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:35.329 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:36.740 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:38.151 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:39.210 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:40.269 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:41.307 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:42.690 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:44.073 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:45.456 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:46.516 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:47.928 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:49.339 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.377 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.416 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.799 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:53.838 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.222 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.606 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.645 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.705 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.764 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.825 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.236 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.622 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.660 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.699 aoe H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:06.738 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:07.777 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:08.815 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.875 aoe G ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.875 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.934 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.346 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.692 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.037 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.049 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.394 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:18.405 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:19.415 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:20.424 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:21.770 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.115 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.115 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:24.174 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom ascendance, lava_surge, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:25.234 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:26.616 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_haste, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:27.607 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.598 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.919 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:30.911 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.257 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.602 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.948 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:35.958 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:37.305 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:38.716 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:40.127 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:41.540 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:42.887 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:44.233 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:45.242 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:46.254 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:47.601 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:48.948 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.960 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:50.953 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:51.991 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:53.374 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:54.414 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:55.797 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.208 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:57.962 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:58.955 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.276 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.268 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.260 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.260 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:03.581 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.591 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:05.912 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:06.902 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:08.222 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.259 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.644 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.655 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.665 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.012 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.358 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.705 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.715 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.062 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.071 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.082 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:22.120 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:23.157 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:23.157 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:24.196 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.234 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:26.617 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:27.656 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.001 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.012 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.359 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.706 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.716 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.064 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:36.055 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:37.375 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:38.760 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:40.143 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:41.182 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:42.593 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:44.004 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:45.062 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:46.474 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:47.534 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.594 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.653 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:50.692 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:52.077 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:53.460 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:54.500 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:55.882 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:57.265 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:58.648 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="edi_cl"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:7:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

fs_fs : 2122800 dps, 1042066 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2122800.2 2122800.2 2544.0 / 0.120% 387801.5 / 18.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
fs_fs 2122800
Chain Lightning 189507 (412460) 9.0% (19.5%) 42.0 6.36sec 2950130 2259430 Direct 167.0 242310 661310 341216 23.6%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.04 167.00 0.00 0.00 1.3057 0.0000 56986501.20 56986501.20 0.00 2259429.83 2259429.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.58 76.39% 242309.73 149101 558915 242873.90 161623 295904 30912466 30912466 0.00
crit 39.43 23.61% 661310.15 412712 1547076 662946.86 440773 1022879 26074035 26074035 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 222953 10.5% 51.3 9.49sec 1307338 0 Direct 228.2 208960 569021 293705 23.5%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.27 228.23 0.00 0.00 0.0000 0.0000 67031342.75 67031342.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.51 76.46% 208960.36 125245 469488 209266.14 135599 308462 36466466 36466466 0.00
crit 53.72 23.54% 569021.49 346678 1299544 570176.85 375503 896211 30564877 30564877 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast2
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 63333 3.0% 9.5 31.73sec 2002364 2033084 Direct 9.5 1377976 3819440 2002348 25.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.50 9.50 0.00 0.00 0.9849 0.0000 19015434.97 19015434.97 0.00 2033084.03 2033084.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.07 74.42% 1377976.03 113953 1618024 1380262.50 926840 1598608 9738846 9738846 0.00
crit 2.43 25.58% 3819439.89 315421 4478691 3555107.87 0 4478691 9276589 9276589 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (705795) 0.0% (33.3%) 48.3 5.82sec 4380021 4339802

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.30 0.00 0.00 0.00 1.0093 0.0000 0.00 0.00 0.00 4339801.90 4339801.90
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 516211 24.3% 286.6 0.97sec 539977 0 Direct 1465.9 75585 209219 105559 22.4%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.58 1465.94 0.00 0.00 0.0000 0.0000 154746282.08 154746282.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1137.12 77.57% 75585.07 67421 84244 75613.45 72631 79067 85950097 85950097 0.00
crit 328.82 22.43% 209218.70 186622 233188 209300.21 200917 218760 68796185 68796185 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 189584 8.9% 73.5 4.37sec 772726 0 Direct 73.5 553138 1531276 772705 22.4%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.53 73.53 0.00 0.00 0.0000 0.0000 56814720.87 56814720.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.02 77.55% 553138.02 527760 599497 553271.10 534707 579264 31539585 31539585 0.00
crit 16.51 22.45% 1531276.00 1460840 1659409 1531608.82 1466701 1617227 25275136 25275136 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast2
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57029 (87341) 2.7% (4.1%) 19.9 15.30sec 1314449 969717 Direct 19.9 596629 1653587 858373 24.8%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.93 19.93 0.00 0.00 1.3555 0.0000 17104765.55 17104765.55 0.00 969716.83 969716.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.99 75.24% 596628.53 528062 659824 596784.94 566787 626541 8944748 8944748 0.00
crit 4.93 24.76% 1653587.29 1461674 1826393 1646249.16 0 1826393 8160017 8160017 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30313 1.4% 12.6 23.48sec 721822 0 Direct 12.6 501026 1389213 721828 24.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.59 12.59 0.00 0.00 0.0000 0.0000 9088255.64 9088255.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.46 75.14% 501025.81 443572 554252 501109.27 456622 539609 4740053 4740053 0.00
crit 3.13 24.86% 1389212.88 1227806 1534170 1338671.07 0 1534170 4348203 4348203 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 198652 9.3% 26.3 11.37sec 2262188 2287224 Direct 26.3 104254 295198 245905 74.2%  
Periodic 301.8 56908 219215 175462 73.0% 133.1%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.26 26.26 301.76 301.76 0.9891 1.3234 59406056.04 59406056.04 0.00 139668.21 2287223.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.78 25.82% 104253.72 93189 116442 104081.00 0 111918 706869 706869 0.00
crit 19.48 74.18% 295197.94 257948 322310 294990.40 276475 310517 5750465 5750465 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.3 26.95% 56907.53 40 64044 56886.47 51935 61030 4628730 4628730 0.00
crit 220.4 73.05% 219215.40 111 248183 219108.22 202791 231506 48319992 48319992 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14523 0.7% 5.1 60.35sec 850512 0 Periodic 48.0 73521 149432 90861 22.8% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.13 0.00 48.00 48.00 0.0000 1.2510 4361110.18 4361110.18 0.00 72633.12 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.0 77.16% 73521.00 114 76542 73507.22 69808 76542 2722800 2722800 0.00
crit 11.0 22.84% 149432.22 475 156146 149423.63 92721 156146 1638310 1638310 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 59755 (133621) 2.8% (6.2%) 7.5 28.54sec 5253332 4357740 Direct 36.1 353044 973083 490096 22.1%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.53 36.09 0.00 0.00 1.2056 0.0000 17687111.39 17687111.39 0.00 4357739.71 4357739.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.11 77.89% 353043.88 172248 908617 353765.39 220974 532321 9923781 9923781 0.00
crit 7.98 22.11% 973082.96 476784 2515052 971539.91 0 2400731 7763330 7763330 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 73866 3.4% 10.9 40.27sec 1997923 0 Direct 53.7 291690 810767 406892 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.94 53.69 0.00 0.00 0.0000 0.0000 21850660.95 21850660.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.78 77.81% 291690.33 144687 763232 292661.65 181325 555840 12187197 12187197 0.00
crit 11.92 22.19% 810767.25 400495 2112627 813373.61 0 1876366 9663463 9663463 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast5
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 151943 (248437) 7.1% (11.7%) 55.5 5.33sec 1339172 1136526 Direct 55.5 251733 819101 819080 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.49 55.49 0.00 0.00 1.1783 0.0000 45451365.68 45451365.68 0.00 1136526.14 1136526.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 251733.08 229983 276204 504.64 0 276204 505 505 0.00
crit 55.49 100.00% 819100.63 701650 1129245 819698.23 784885 864286 45450861 45450861 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77804 3.7% 35.2 8.37sec 661652 0 Direct 35.2 210882 661674 661659 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.17 35.17 0.00 0.00 0.0000 0.0000 23272446.35 23272446.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 210882.09 193186 221882 246.60 0 221882 247 247 0.00
crit 35.17 100.00% 661673.57 566884 912350 662163.73 623804 708445 23272200 23272200 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18691 0.9% 41.2 6.62sec 135476 0 Direct 94.7 47040 95899 59028 24.5%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.25 94.67 0.00 0.00 0.0000 0.0000 5587949.55 5587949.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.44 75.46% 47040.10 44808 50897 47044.72 44896 50408 3360542 3360542 0.00
crit 23.23 24.54% 95898.67 91408 103831 95917.20 91408 103831 2227408 2227408 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 41880 (81640) 2.0% (3.9%) 38.3 7.64sec 641392 504987 Direct 38.3 227911 616171 329125 26.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.29 38.29 0.00 0.00 1.2701 0.0000 12602256.22 12602256.22 0.00 504987.39 504987.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.31 73.93% 227910.99 156284 585841 229113.05 169832 359438 6451872 6451872 0.00
crit 9.98 26.07% 616171.39 432595 1621608 616472.20 0 1388486 6150384 6150384 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 39761 1.9% 43.2 9.10sec 277001 0 Direct 43.2 192315 521130 276981 25.7%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.16 43.16 0.00 0.00 0.0000 0.0000 11955785.59 11955785.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.05 74.25% 192314.78 131279 492107 192655.33 142122 335276 6163910 6163910 0.00
crit 11.11 25.75% 521130.37 363380 1362151 522409.29 376474 1124069 5791876 5791876 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45587 (66908) 2.1% (3.1%) 3.0 120.35sec 6677738 0 Direct 94.4 116064 236771 143895 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.35 94.35 0.00 0.0000 0.6133 13576793.20 13576793.20 0.00 344285.58 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.60 76.94% 116064.33 116064 116064 116064.33 116064 116064 8425813 8425813 0.00
crit 21.76 23.06% 236771.23 236771 236771 236771.23 236771 236771 5150981 5150981 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21321 1.0% 37.8 6.90sec 167749 0 Direct 37.8 135409 276235 167747 23.0%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.83 37.83 0.00 0.00 0.0000 0.0000 6345980.63 6345980.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.14 77.04% 135409.19 135409 135409 135409.19 135409 135409 3946162 3946162 0.00
crit 8.69 22.96% 276234.76 276235 276235 276234.76 276235 276235 2399818 2399818 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134039 / 85953
Fire Blast 134039 4.0% 96.8 2.98sec 265378 136471 Direct 96.8 213189 426349 265375 24.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.75 96.75 0.00 0.00 1.9446 0.0000 25675403.52 25675403.52 0.00 136471.12 136471.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.06 75.52% 213189.30 201607 229011 213239.23 207679 221718 15576270 15576270 0.00
crit 23.69 24.48% 426349.14 403214 458023 426458.14 411297 448357 10099133 10099133 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 177867 / 24136
Lightning Blast 177867 1.1% 37.7 7.49sec 192081 194953 Direct 37.7 156715 313551 192081 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.70 37.70 0.00 0.00 0.9853 0.0000 7240752.33 7240752.33 0.00 194953.08 194953.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.20 77.45% 156715.21 149339 169638 156768.32 151192 165926 4575422 4575422 0.00
crit 8.50 22.55% 313551.01 298677 339276 313636.00 298677 339276 2665331 2665331 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
fs_fs
Ascendance 2.0 181.93sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 106.76sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.45 0.00 0.00 0.00 1.0433 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:fs_fs
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.24sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8312 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.65sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 14.77% 0.0(0.0) 2.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.5sec 25.1sec 32.07% 32.07% 3.1(3.1) 8.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.5 1.3 29.7sec 25.8sec 31.43% 31.43% 1.3(1.3) 9.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.5 1.3 29.6sec 25.7sec 31.41% 31.41% 1.3(1.3) 9.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.2 1.6 30.6sec 25.7sec 30.52% 30.52% 1.6(1.6) 8.9

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 75.6 34.6 4.0sec 2.7sec 77.53% 71.91% 34.6(34.6) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.81%
  • elemental_focus_2:57.72%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.0sec 60.0sec 19.20% 19.20% 0.0(0.0) 4.7

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 23.4 6.8 12.4sec 9.5sec 25.51% 42.18% 6.9(6.9) 1.3

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.51%

Trigger Attempt Success

  • trigger_pct:99.85%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.0sec 29.79% 29.79% 4.3(4.3) 12.6

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 84.2sec 84.2sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.42%
Potion of Prolonged Power 2.0 0.0 91.1sec 0.0sec 39.89% 39.89% 0.0(0.0) 2.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.0 2.3 47.5sec 32.7sec 31.42% 39.15% 2.3(5.7) 2.2

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.98%
  • power_of_the_maelstrom_2:7.39%
  • power_of_the_maelstrom_3:18.05%

Trigger Attempt Success

  • trigger_pct:15.05%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.7sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 4.9 0.0 46.1sec 46.1sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:9.99%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.9sec 62.2sec 11.78% 9.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.33%
  • stormkeeper_2:3.78%
  • stormkeeper_3:3.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.7sec 100.00% 98.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:fs_fs
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 30.3 9.5sec
Lava Surge: Wasted 7.0 31.7sec
Lava Surge: During Lava Burst 4.3 54.0sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.5700.00117.44616.0540.02119.654
Fire Elemental0.5130.0011.8870.6350.0003.490
Ascendance2.1350.00210.0581.9310.00010.058
Lava Burst3.0200.00134.35745.0649.648111.899
Elemental Blast2.1500.00118.23936.24919.27467.258

Resources

Resource Usage Type Count Total Average RPE APR
fs_fs
earth_shock Maelstrom 72.5 8608.3 118.7 906.5 2209.0
earthquake Maelstrom 368.8 18442.4 50.0 381.8 11471.5
flame_shock Maelstrom 200.5 3796.3 18.9 144.6 15648.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 423.70 5029.13 (16.12%) 11.87 55.26 1.09%
Lava Burst Overload Maelstrom 268.57 2354.97 (7.55%) 8.77 62.20 2.57%
Lava Beam Maelstrom 57.46 1611.72 (5.16%) 28.05 41.48 2.51%
Lava Beam Overload Maelstrom 83.53 1564.69 (5.01%) 18.73 75.63 4.61%
Chain Lightning Maelstrom 320.98 7515.41 (24.08%) 23.41 135.82 1.78%
Chain Lightning Overload Maelstrom 391.52 6589.92 (21.12%) 16.83 381.27 5.47%
Lightning Bolt Maelstrom 292.36 2330.22 (7.47%) 7.97 8.66 0.37%
Lightning Bolt Overload Maelstrom 329.57 1958.32 (6.28%) 5.94 19.13 0.97%
Resonance Totem Maelstrom 2280.46 2250.94 (7.21%) 0.99 29.52 1.29%
Resource RPS-Gain RPS-Loss
Maelstrom 13.62 13.46
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 47.28 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data fs_fs Fight Length
Count 5986
Mean 300.04
Minimum 240.04
Maximum 360.04
Spread ( max - min ) 120.00
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 35.3985
5th Percentile 245.28
95th Percentile 354.77
( 95th Percentile - 5th Percentile ) 109.49
Mean Distribution
Standard Deviation 0.4575
95.00% Confidence Intervall ( 299.14 - 300.93 )
Normalized 95.00% Confidence Intervall ( 99.70% - 100.30% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 535
0.1% Error 53471
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1070
DPS
Sample Data fs_fs Damage Per Second
Count 5986
Mean 2122800.21
Minimum 1773938.41
Maximum 2594472.96
Spread ( max - min ) 820534.54
Range [ ( max - min ) / 2 * 100% ] 19.33%
Standard Deviation 100424.4437
5th Percentile 1967277.33
95th Percentile 2295217.57
( 95th Percentile - 5th Percentile ) 327940.24
Mean Distribution
Standard Deviation 1297.9892
95.00% Confidence Intervall ( 2120256.20 - 2125344.22 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 86
0.1% Error 8598
0.1 Scale Factor Error with Delta=300 86091949
0.05 Scale Factor Error with Delta=300 344367795
0.01 Scale Factor Error with Delta=300 8609194866
Priority Target DPS
Sample Data fs_fs Priority Target Damage Per Second
Count 5986
Mean 1042066.37
Minimum 904231.52
Maximum 1215541.73
Spread ( max - min ) 311310.20
Range [ ( max - min ) / 2 * 100% ] 14.94%
Standard Deviation 40001.6008
5th Percentile 978272.39
95th Percentile 1110804.94
( 95th Percentile - 5th Percentile ) 132532.54
Mean Distribution
Standard Deviation 517.0220
95.00% Confidence Intervall ( 1041053.03 - 1043079.72 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5661
0.1 Scale Factor Error with Delta=300 13659614
0.05 Scale Factor Error with Delta=300 54638455
0.01 Scale Factor Error with Delta=300 1365961352
DPS(e)
Sample Data fs_fs Damage Per Second (Effective)
Count 5986
Mean 2122800.21
Minimum 1773938.41
Maximum 2594472.96
Spread ( max - min ) 820534.54
Range [ ( max - min ) / 2 * 100% ] 19.33%
Damage
Sample Data fs_fs Damage
Count 5986
Mean 602884818.85
Minimum 426723077.77
Maximum 795960624.78
Spread ( max - min ) 369237547.00
Range [ ( max - min ) / 2 * 100% ] 30.62%
DTPS
Sample Data fs_fs Damage Taken Per Second
Count 5986
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data fs_fs Healing Per Second
Count 5986
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data fs_fs Healing Per Second (Effective)
Count 5986
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data fs_fs Heal
Count 5986
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data fs_fs Healing Taken Per Second
Count 5986
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data fs_fs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data fs_fsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data fs_fs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.03 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.09 totem_mastery,if=buff.resonance_totem.remains<2
9 3.56 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.36 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 4.05 stormkeeper
G 0.18 ascendance
0.00 liquid_magma_totem
H 2.05 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 49.77 earthquake
J 1.63 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.75 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.75 lava_beam
M 35.89 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.15 lava_burst,moving=1
O 0.09 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.88 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.21 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.86 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.90 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.69 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.25 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.25 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 55.72 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.70 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.72 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.01 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 13.91 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.09 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 23.99 lightning_bolt
e 0.16 flame_shock,moving=1,target_if=refreshable
f 0.37 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddPWWWTWWWSILLIILAILIMWWXSXbbWTWbXdXWWXSdWIMMIMIMISWWWXXddWdTSWXdWFMIMIMIAM97STWWWddddTWSXcXXMMIIMMIMSWW8WATdWXWXdSWdWWIFIMIIMAIMISWWXbbTbWbXXSddWIMIMIMMIIJIKMMIIM9IGLLWSQLIFILLAIIIWSWddddWTccSWWQIMIMMIIMSW8WWXAXbbWWWSYbWQWMIMFMIAMIMIJKMWbbbWTddXSQWMM9IIMIMSWWX

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation fs_fs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.057 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.057 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.872 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.959 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.044 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.079 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.857 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.636 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.415 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.195 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.195 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.231 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.268 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.304 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.083 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.863 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.899 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.986 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.072 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.890 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.976 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.064 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.880 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.696 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.784 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.784 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.582 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.648 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.448 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.512 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.310 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.375 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.173 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.260 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.075 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.165 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.252 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.070 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.887 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:34.975 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:36.064 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:36.879 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:37.965 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:38.782 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:39.598 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:40.685 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:41.503 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:42.887 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:44.269 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:45.309 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:46.348 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:47.731 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.141 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.202 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.614 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.672 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.081 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.141 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.553 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.613 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.023 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.083 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.142 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.202 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.616 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.999 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:06.384 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.768 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:08.806 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:10.189 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.250 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.310 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.722 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:15.132 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:16.193 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.252 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:18.311 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:19.370 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:20.429 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:21.488 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.547 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.547 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:23.960 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.061 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.061 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:26.471 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:27.530 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.940 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.999 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.409 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.821 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:34.231 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.642 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:37.054 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:38.115 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.526 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:40.909 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:41.947 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:43.331 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:44.369 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:45.407 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:46.792 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:48.176 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:49.214 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:50.274 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.686 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:53.068 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:54.106 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:55.491 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:56.875 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:57.912 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.324 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:00.080 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.140 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.140 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.200 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.612 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.670 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.731 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.142 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.201 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.614 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.025 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:12.036 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.382 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.728 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:15.738 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:16.749 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:17.741 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:18.733 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:19.723 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:20.716 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:21.708 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.747 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.747 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.806 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.866 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.924 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.335 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.346 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.693 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.704 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.052 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.045 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom movement, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.035 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.356 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:36.675 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:37.996 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:39.056 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:40.115 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:41.526 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:42.911 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:44.293 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:45.677 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:46.714 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:48.097 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.155 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.566 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.625 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.035 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.446 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.506 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.564 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.625 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.684 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.095 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.507 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.918 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.977 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.037 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.450 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.510 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.570 aoe G ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.570 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.982 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.396 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.807 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.218 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.277 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.688 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.747 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:18.807 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:19.867 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:21.279 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:22.663 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:22.663 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:23.702 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:24.740 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:25.781 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:26.820 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.232 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_mastery, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.643 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.704 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.115 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:33.498 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 104.0/125: 83% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:34.881 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:36.264 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:37.303 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:38.687 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:40.097 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.637 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:42.695 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.106 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:45.164 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:46.226 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:47.638 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.698 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.109 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.521 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:52.580 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.640 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.052 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.464 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.524 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.280 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.624 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.636 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.647 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.647 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.655 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.003 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.347 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.358 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.367 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:08.750 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:10.136 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.127 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.446 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.438 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.448 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.795 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.142 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.153 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.500 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.511 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.571 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.630 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.630 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.691 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.750 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.810 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.867 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.928 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.340 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.753 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.098 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:33.418 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:34.738 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:36.058 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:37.377 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:38.368 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:39.715 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:41.037 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:42.076 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:43.461 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:44.501 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:45.885 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:47.297 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.708 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.766 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.826 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.886 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.297 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:54.334 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:55.717 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:57.102 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:58.485 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:59.804 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="fs_fs"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:7:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

li_lvb : 2107820 dps, 1039342 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2107819.6 2107819.6 2527.1 / 0.120% 391833.7 / 18.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
li_lvb 2107820
Chain Lightning 188631 (410677) 9.0% (19.6%) 42.0 6.43sec 2942234 2252881 Direct 166.7 242243 658709 340340 23.6%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.97 166.67 0.00 0.00 1.3060 0.0000 56722854.10 56722854.10 0.00 2252881.30 2252881.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.42 76.45% 242242.63 149101 558915 242823.68 163912 308408 30865589 30865589 0.00
crit 39.25 23.55% 658709.29 412712 1547076 660262.39 444843 923055 25857265 25857265 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 222046 10.6% 51.3 9.51sec 1302870 0 Direct 227.8 208472 568902 293111 23.5%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.25 227.82 0.00 0.00 0.0000 0.0000 66773340.09 66773340.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.32 76.52% 208472.33 125245 469488 208787.58 136715 319593 36340640 36340640 0.00
crit 53.50 23.48% 568902.34 346678 1299544 570236.97 369082 979817 30432700 30432700 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast3
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 63276 3.0% 9.5 31.75sec 1989240 2020018 Direct 9.5 1377795 3815524 1989231 25.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.55 9.55 0.00 0.00 0.9848 0.0000 18996252.49 18996252.49 0.00 2020018.34 2020018.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.15 74.92% 1377795.24 103593 1618024 1380124.01 0 1618024 9856941 9856941 0.00
crit 2.40 25.08% 3815524.07 315421 4478691 3544983.16 0 4478691 9139311 9139311 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (704349) 0.0% (33.4%) 48.2 5.82sec 4375587 4335194

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.24 0.00 0.00 0.00 1.0093 0.0000 0.00 0.00 0.00 4335194.22 4335194.22
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 515777 24.5% 286.1 0.97sec 540356 0 Direct 1464.0 75602 209283 105588 22.4%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.07 1464.00 0.00 0.00 0.0000 0.0000 154580996.65 154580996.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1135.61 77.57% 75602.22 67421 84244 75628.05 72453 79309 85854451 85854451 0.00
crit 328.39 22.43% 209283.22 186622 233188 209357.89 199961 220421 68726546 68726546 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 188572 8.9% 73.1 4.35sec 772570 0 Direct 73.1 553322 1530888 772550 22.4%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.13 73.13 0.00 0.00 0.0000 0.0000 56495274.78 56495274.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.73 77.57% 553321.68 527760 599497 553434.36 534587 579137 31387389 31387389 0.00
crit 16.40 22.43% 1530888.13 1460840 1659409 1531232.34 1467287 1631042 25107885 25107885 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast6
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57097 (87456) 2.7% (4.2%) 19.9 15.31sec 1316757 971458 Direct 19.9 596502 1653628 859483 24.9%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.92 19.92 0.00 0.00 1.3555 0.0000 17118770.99 17118770.99 0.00 971458.42 971458.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.96 75.12% 596502.08 528062 659824 596655.55 565425 630657 8925203 8925203 0.00
crit 4.95 24.88% 1653627.79 1461674 1826393 1647530.04 0 1826393 8193568 8193568 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30359 1.4% 12.6 23.28sec 723049 0 Direct 12.6 501207 1388998 723040 25.0%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.60 12.60 0.00 0.00 0.0000 0.0000 9107691.85 9107691.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.45 75.01% 501207.22 443572 554252 501365.51 466871 554252 4735882 4735882 0.00
crit 3.15 24.99% 1388998.10 1227806 1534170 1340399.69 0 1534170 4371809 4371809 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 167791 7.9% 26.1 11.44sec 1923365 1944715 Direct 26.1 88214 249778 207896 74.1%  
Periodic 301.2 48156 185506 148583 73.1% 132.8%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.09 26.09 301.20 301.20 0.9891 1.3232 50177540.30 50177540.30 0.00 118244.81 1944715.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.76 25.92% 88213.99 78852 98528 88082.10 0 94700 596494 596494 0.00
crit 19.33 74.08% 249777.84 218264 272724 249622.29 235215 262553 4827281 4827281 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.0 26.88% 48156.03 31 54191 48139.63 43902 51511 3898908 3898908 0.00
crit 220.2 73.12% 185505.97 149 210001 185428.86 170926 196106 40854857 40854857 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14532 0.7% 5.1 60.36sec 851712 0 Periodic 48.0 73500 149575 90918 22.9% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.99 47.99 0.0000 1.2508 4363361.32 4363361.32 0.00 72686.35 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.0 77.10% 73500.47 111 76542 73487.38 70364 76542 2719852 2719852 0.00
crit 11.0 22.90% 149575.03 233 156146 149536.89 95702 156146 1643510 1643510 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 59507 (133441) 2.8% (6.3%) 7.5 28.79sec 5265990 4368846 Direct 36.0 352238 969700 489154 22.2%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.50 35.99 0.00 0.00 1.2055 0.0000 17602650.35 17602650.35 0.00 4368846.39 4368846.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.01 77.83% 352238.39 172248 908617 352935.11 219063 535475 9865760 9865760 0.00
crit 7.98 22.17% 969699.84 476784 2515052 969731.36 0 2303594 7736891 7736891 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 73934 3.5% 11.0 40.69sec 1995706 0 Direct 53.9 292536 805301 406073 22.1%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.97 53.88 0.00 0.00 0.0000 0.0000 21882983.35 21882983.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.95 77.85% 292535.61 144687 763232 292830.07 181333 638083 12272268 12272268 0.00
crit 11.93 22.15% 805300.57 400495 2112627 806299.49 0 1801545 9610715 9610715 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 164024 (267086) 7.8% (12.7%) 55.4 5.30sec 1440711 1221913 Direct 55.4 276945 884796 884769 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.45 55.45 0.00 0.00 1.1791 0.0000 49057226.62 49057226.62 0.00 1221913.12 1221913.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 276944.91 248464 298399 698.30 0 298399 698 698 0.00
crit 55.44 100.00% 884796.13 758033 1219988 885418.07 846228 942009 49056528 49056528 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 84215 4.0% 35.3 8.28sec 714554 0 Direct 35.3 224689 714573 714557 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.25 35.25 0.00 0.00 0.0000 0.0000 25191008.79 25191008.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.00% 224688.51 208709 229580 264.38 0 229580 264 264 0.00
crit 35.25 100.00% 714573.14 612437 985664 715084.95 671410 775927 25190744 25190744 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18847 0.9% 41.5 6.53sec 135610 0 Direct 95.5 47022 95849 58970 24.5%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.55 95.55 0.00 0.00 0.0000 0.0000 5634334.80 5634334.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.17 75.53% 47022.49 44808 50897 47027.77 44808 50778 3393548 3393548 0.00
crit 23.38 24.47% 95849.08 91408 103831 95858.45 0 103831 2240787 2240787 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 42142 (82126) 2.0% (3.9%) 38.5 7.60sec 641603 505247 Direct 38.5 228050 616967 329276 26.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.48 38.48 0.00 0.00 1.2699 0.0000 12670180.79 12670180.79 0.00 505247.11 505247.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.47 73.98% 228050.39 156284 585841 229066.74 172990 360644 6491856 6491856 0.00
crit 10.01 26.02% 616967.42 432595 1621608 619136.50 0 1221229 6178324 6178324 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 39985 1.9% 43.3 9.05sec 277523 0 Direct 43.3 192582 520829 277546 25.9%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.31 43.31 0.00 0.00 0.0000 0.0000 12019729.74 12019729.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.10 74.12% 192582.10 131279 492107 192982.46 143042 356666 6181701 6181701 0.00
crit 11.21 25.88% 520829.25 363380 1362151 521501.85 363380 1099492 5838029 5838029 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45592 (66960) 2.2% (3.2%) 3.0 120.34sec 6677778 0 Direct 94.4 116064 236771 143875 23.0%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 94.36 94.36 0.00 0.0000 0.6133 13575674.28 13575674.28 0.00 344489.17 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.62 76.96% 116064.33 116064 116064 116064.33 116064 116064 8428955 8428955 0.00
crit 21.74 23.04% 236771.23 236771 236771 236771.23 236771 236771 5146720 5146720 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21369 1.0% 37.8 7.00sec 168203 0 Direct 37.8 135409 276235 168199 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.80 37.80 0.00 0.00 0.0000 0.0000 6358880.42 6358880.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.00 76.71% 135409.19 135409 135409 135409.19 135409 135409 3927049 3927049 0.00
crit 8.80 23.29% 276234.76 276235 276235 276141.89 0 276235 2431832 2431832 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134042 / 86006
Fire Blast 134042 4.1% 96.8 2.99sec 265399 136494 Direct 96.8 213167 426295 265397 24.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.79 96.79 0.00 0.00 1.9444 0.0000 25686728.67 25686728.67 0.00 136493.59 136493.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.07 75.49% 213167.40 201607 229011 213221.94 206856 220635 15575157 15575157 0.00
crit 23.72 24.51% 426295.01 403214 458023 426417.62 410688 445062 10111572 10111572 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 177926 / 24118
Lightning Blast 177926 1.1% 37.7 7.49sec 192166 195051 Direct 37.7 156749 313862 192171 22.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.65 37.65 0.00 0.00 0.9852 0.0000 7235237.36 7235237.36 0.00 195051.42 195051.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.16 77.46% 156749.28 149339 169638 156801.74 151058 166046 4571266 4571266 0.00
crit 8.49 22.54% 313861.88 298677 339276 313910.00 0 339276 2663971 2663971 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
li_lvb
Ascendance 2.0 181.93sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 106.68sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.46 0.00 0.00 0.00 1.0428 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:li_lvb
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.19sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8313 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.67sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5059 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 14.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.6sec 25.1sec 32.03% 32.03% 3.1(3.1) 7.9

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.5 1.3 29.7sec 25.8sec 31.41% 31.41% 1.3(1.3) 9.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.6sec 25.7sec 31.47% 31.47% 1.3(1.3) 9.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.2 1.6 30.7sec 25.8sec 30.47% 30.47% 1.6(1.6) 8.9

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 75.6 34.6 4.0sec 2.7sec 77.45% 71.86% 34.6(34.6) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.78%
  • elemental_focus_2:57.67%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.0sec 60.0sec 19.20% 19.20% 0.0(0.0) 4.7

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 23.3 6.7 12.4sec 9.6sec 25.34% 41.86% 6.8(6.8) 1.3

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.34%

Trigger Attempt Success

  • trigger_pct:99.85%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.0sec 29.85% 29.85% 4.3(4.3) 12.6

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.2sec 85.2sec 0.36% 0.36% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.36%

Trigger Attempt Success

  • trigger_pct:79.22%
Potion of Prolonged Power 2.0 0.0 91.1sec 0.0sec 39.90% 39.90% 0.0(0.0) 2.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.90%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.0 2.3 47.1sec 32.9sec 31.31% 38.90% 2.3(5.5) 2.2

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.00%
  • power_of_the_maelstrom_2:7.37%
  • power_of_the_maelstrom_3:17.94%

Trigger Attempt Success

  • trigger_pct:14.94%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.7sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 4.9 0.0 46.0sec 46.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.05%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.9sec 62.2sec 11.75% 9.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.27%
  • stormkeeper_2:3.81%
  • stormkeeper_3:3.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.7sec 100.00% 98.11% 2.0(2.0) 0.0

Buff details

  • buff initial source:li_lvb
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 30.0 9.6sec
Lava Surge: Wasted 6.8 31.8sec
Lava Surge: During Lava Burst 4.3 54.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.5810.00117.29316.0120.00020.049
Fire Elemental0.5030.0011.8220.6130.0003.100
Ascendance2.1270.0019.2171.9190.0009.217
Lava Burst3.0110.00134.69244.5985.243106.680
Elemental Blast2.1410.00120.41336.06817.60066.869

Resources

Resource Usage Type Count Total Average RPE APR
li_lvb
earth_shock Maelstrom 74.1 8792.4 118.7 920.7 2160.5
earthquake Maelstrom 374.2 18709.2 50.0 387.8 11281.9
flame_shock Maelstrom 202.4 3826.9 18.9 146.7 13111.8
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 430.06 5103.41 (16.10%) 11.87 57.31 1.11%
Lava Burst Overload Maelstrom 273.43 2396.13 (7.56%) 8.76 64.77 2.63%
Lava Beam Maelstrom 58.16 1632.30 (5.15%) 28.06 42.49 2.54%
Lava Beam Overload Maelstrom 85.05 1595.67 (5.04%) 18.76 76.15 4.55%
Chain Lightning Maelstrom 325.57 7617.60 (24.04%) 23.40 139.03 1.79%
Chain Lightning Overload Maelstrom 397.54 6684.81 (21.09%) 16.82 383.72 5.43%
Lightning Bolt Maelstrom 298.48 2378.51 (7.51%) 7.97 9.29 0.39%
Lightning Bolt Overload Maelstrom 335.92 1995.24 (6.30%) 5.94 20.26 1.00%
Resonance Totem Maelstrom 2316.26 2286.28 (7.21%) 0.99 29.98 1.29%
Resource RPS-Gain RPS-Loss
Maelstrom 13.62 13.46
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 45.09 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data li_lvb Fight Length
Count 5949
Mean 300.01
Minimum 239.97
Maximum 360.07
Spread ( max - min ) 120.10
Range [ ( max - min ) / 2 * 100% ] 20.02%
Standard Deviation 35.4747
5th Percentile 245.43
95th Percentile 354.59
( 95th Percentile - 5th Percentile ) 109.16
Mean Distribution
Standard Deviation 0.4599
95.00% Confidence Intervall ( 299.11 - 300.91 )
Normalized 95.00% Confidence Intervall ( 99.70% - 100.30% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 538
0.1% Error 53712
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1075
DPS
Sample Data li_lvb Damage Per Second
Count 5949
Mean 2107819.64
Minimum 1806652.80
Maximum 2496464.68
Spread ( max - min ) 689811.89
Range [ ( max - min ) / 2 * 100% ] 16.36%
Standard Deviation 99447.4621
5th Percentile 1948159.44
95th Percentile 2277313.82
( 95th Percentile - 5th Percentile ) 329154.38
Mean Distribution
Standard Deviation 1289.3527
95.00% Confidence Intervall ( 2105292.55 - 2110346.72 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 86
0.1% Error 8551
0.1 Scale Factor Error with Delta=300 84425002
0.05 Scale Factor Error with Delta=300 337700007
0.01 Scale Factor Error with Delta=300 8442500160
Priority Target DPS
Sample Data li_lvb Priority Target Damage Per Second
Count 5949
Mean 1039341.90
Minimum 905726.22
Maximum 1186530.51
Spread ( max - min ) 280804.29
Range [ ( max - min ) / 2 * 100% ] 13.51%
Standard Deviation 41065.1865
5th Percentile 974050.49
95th Percentile 1108382.70
( 95th Percentile - 5th Percentile ) 134332.22
Mean Distribution
Standard Deviation 532.4169
95.00% Confidence Intervall ( 1038298.38 - 1040385.42 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 60
0.1% Error 5997
0.1 Scale Factor Error with Delta=300 14395650
0.05 Scale Factor Error with Delta=300 57582599
0.01 Scale Factor Error with Delta=300 1439564962
DPS(e)
Sample Data li_lvb Damage Per Second (Effective)
Count 5949
Mean 2107819.64
Minimum 1806652.80
Maximum 2496464.68
Spread ( max - min ) 689811.89
Range [ ( max - min ) / 2 * 100% ] 16.36%
Damage
Sample Data li_lvb Damage
Count 5949
Mean 598328751.72
Minimum 431448191.17
Maximum 794304144.24
Spread ( max - min ) 362855953.07
Range [ ( max - min ) / 2 * 100% ] 30.32%
DTPS
Sample Data li_lvb Damage Taken Per Second
Count 5949
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data li_lvb Healing Per Second
Count 5949
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data li_lvb Healing Per Second (Effective)
Count 5949
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data li_lvb Heal
Count 5949
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data li_lvb Healing Taken Per Second
Count 5949
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data li_lvb Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data li_lvbTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data li_lvb Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.02 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.07 totem_mastery,if=buff.resonance_totem.remains<2
9 3.54 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.30 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 4.01 stormkeeper
G 0.18 ascendance
0.00 liquid_magma_totem
H 1.98 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 49.39 earthquake
J 1.63 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.72 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.68 lava_beam
M 35.66 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.15 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.87 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.22 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.84 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 18.81 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.71 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.27 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.25 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 55.34 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 16.42 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.70 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.01 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 13.78 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.07 lightning_bolt
e 0.17 flame_shock,moving=1,target_if=refreshable
f 0.37 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddPWWWWTWWLILIILALIIMMSWWXXbbbTdWWXXSXdddWIMIMIMIMSWWXXWbbWWTbSWXWdFIMIMIAMIIMSW97WWXcXWXWSWTWdMIIMMIIMSW8WWAXXbbXWWSbTdWMFIIMIAMIMSWXXWbbbIIMKMMIMIMIIMIMIIKMHMHMHHWWWPSWW9WHIIFLLAILISWWXbbddWbXSWTbWMIIMIMIMS8WWWQAXXcWWWSYWdfWMIMIFMAIIMSWdTQWbbbdWSTdddMIMIIMIMQSWW

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation li_lvb 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.060 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.876 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:02.963 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.028 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.093 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.892 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.690 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.489 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:08.289 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.289 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.375 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:10.440 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:11.505 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:12.571 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:13.369 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:14.434 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:15.497 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.582 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.399 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.486 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.284 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.083 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.150 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.150 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.215 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.014 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.814 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.879 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.966 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.051 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.088 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.124 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.903 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.683 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.719 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom bloodlust, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.756 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.793 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom bloodlust, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:34.571 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:35.607 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:36.385 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:37.422 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:38.200 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:39.017 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:40.134 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:40.913 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:41.950 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:43.296 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:44.642 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:45.652 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.662 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.006 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.015 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.362 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.373 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.785 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.845 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.256 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.669 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.681 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.028 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.019 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.010 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:02.001 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:03.322 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.643 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:05.635 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.982 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.040 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.452 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.864 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.923 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.934 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.279 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.625 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.636 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.646 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_critical_strike, elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.657 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.667 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.678 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.688 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.688 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.746 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:23.805 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:24.865 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:26.276 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:27.688 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.101 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.160 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:30.160 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:31.220 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:32.631 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:33.690 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:35.102 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:36.162 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:37.220 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:38.279 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:39.688 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.100 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:42.160 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:43.173 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:44.522 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:45.868 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.215 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.227 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.238 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.585 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.932 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:52.972 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.010 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:55.394 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:56.777 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.161 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.917 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.263 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.254 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.254 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.245 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.237 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.559 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.880 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:06.871 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.192 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:09.230 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:10.611 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:11.932 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:12.924 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:14.246 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:15.593 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.940 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.951 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:18.962 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.971 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_haste, elemental_blast_mastery, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.983 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.043 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.043 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.102 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.162 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.222 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.633 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.044 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.104 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.165 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.577 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.989 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:34.049 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:35.461 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:36.521 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:37.582 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:38.993 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:40.404 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:41.817 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:43.162 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:44.172 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:45.518 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:46.528 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.875 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.888 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.898 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.245 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.305 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.716 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.776 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.836 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.247 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.631 aoe H flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.670 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.054 aoe H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.091 aoe M chain_lightning Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.473 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.512 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.549 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.609 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.670 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.081 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.081 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.655 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.666 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom ascendance, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.014 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom ascendance, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.024 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom ascendance, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.371 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.381 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.392 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom ascendance, lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:18.402 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom ascendance, lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:19.412 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom ascendance, lava_surge, elemental_blast_haste, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:20.758 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom ascendance, lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:22.169 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:22.169 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.230 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:24.642 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:25.701 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.112 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:28.172 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.518 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.530 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.876 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.223 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.570 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:35.917 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:37.263 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.610 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.670 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.081 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:42.119 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:43.110 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:44.432 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:45.752 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:47.073 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/125: 56% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.083 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.093 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.439 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.449 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.794 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:53.830 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:55.212 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:56.593 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:57.348 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:58.338 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.685 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.697 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.706 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.706 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.717 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.728 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.074 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.086 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.433 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:08.472 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 114.0/125: 91% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.976 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.968 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.959 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:13.005 single_asc f earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom movement, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.014 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.360 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:16.706 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.716 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:19.063 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.074 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:21.136 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:22.194 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.194 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.253 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:24.311 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:25.369 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:26.780 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:28.192 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_critical_strike, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:29.251 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.310 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:31.371 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.783 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.196 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:35.608 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:37.020 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:38.404 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:39.787 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:41.168 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:42.161 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:43.480 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:44.825 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:46.172 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:47.518 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.529 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:49.849 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:50.840 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 92.0/125: 74% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:51.832 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:53.216 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:54.255 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:55.638 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.699 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.108 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.520 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="li_lvb"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:7:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

mb_lvs : 2104417 dps, 1034637 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2104417.1 2104417.1 2523.8 / 0.120% 377572.8 / 17.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
mb_lvs 2104417
Chain Lightning 188854 (411653) 9.0% (19.6%) 42.0 6.36sec 2950215 2259532 Direct 166.6 242316 660244 340842 23.6%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.96 166.60 0.00 0.00 1.3057 0.0000 56783080.37 56783080.37 0.00 2259532.12 2259532.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.33 76.43% 242315.76 149101 558915 242874.43 162750 304466 30851740 30851740 0.00
crit 39.27 23.57% 660244.22 412712 1547076 661952.75 444997 940938 25931340 25931340 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 222799 10.6% 51.2 9.41sec 1308234 0 Direct 227.8 209127 570304 294178 23.5%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.22 227.80 0.00 0.00 0.0000 0.0000 67005386.59 67005386.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 174.16 76.45% 209126.72 125245 469488 209373.87 135871 311374 36416807 36416807 0.00
crit 53.64 23.55% 570303.78 346678 1299544 572019.49 370021 959292 30588580 30588580 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 63453 3.0% 9.5 31.54sec 2003748 2034823 Direct 9.5 1380069 3818696 2003606 25.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.50 9.50 0.00 0.00 0.9848 0.0000 19039838.77 19039838.77 0.00 2034823.00 2034823.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.07 74.42% 1380069.37 103593 1618024 1381952.86 855912 1553904 9759372 9759372 0.00
crit 2.43 25.58% 3818695.82 315421 4478691 3568400.59 0 4478691 9280467 9280467 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (704716) 0.0% (33.5%) 48.2 5.82sec 4378237 4337886

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.25 0.00 0.00 0.00 1.0093 0.0000 0.00 0.00 0.00 4337885.89 4337885.89
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 515945 24.5% 286.2 0.97sec 540321 0 Direct 1464.9 75593 209251 105571 22.4%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.21 1464.87 0.00 0.00 0.0000 0.0000 154647039.64 154647039.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1136.33 77.57% 75593.20 67421 84244 75621.18 72869 79592 85898467 85898467 0.00
crit 328.55 22.43% 209251.06 186622 233188 209335.28 200954 219700 68748572 68748572 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 188771 9.0% 73.2 4.36sec 772607 0 Direct 73.2 553366 1531242 772595 22.4%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.24 73.24 0.00 0.00 0.0000 0.0000 56586313.86 56586313.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.82 77.58% 553365.64 527760 599497 553500.78 534619 580174 31442266 31442266 0.00
crit 16.42 22.42% 1531241.62 1460840 1659409 1531539.39 1467287 1626744 25144048 25144048 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast2
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57263 (87546) 2.7% (4.2%) 19.9 15.29sec 1316640 971293 Direct 19.9 596886 1653202 861207 25.0%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.94 19.94 0.00 0.00 1.3556 0.0000 17174871.50 17174871.50 0.00 971293.03 971293.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.95 74.98% 596886.32 528062 659824 596999.65 566661 627934 8924686 8924686 0.00
crit 4.99 25.02% 1653202.01 1461674 1826393 1647312.07 0 1826393 8250185 8250185 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30283 1.4% 12.6 23.16sec 722131 0 Direct 12.6 501414 1389318 722146 24.9%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.58 12.58 0.00 0.00 0.0000 0.0000 9082092.87 9082092.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.45 75.14% 501414.34 443572 554252 501493.19 464502 539896 4738621 4738621 0.00
crit 3.13 24.86% 1389318.29 1227806 1534170 1339354.26 0 1534170 4343472 4343472 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 168080 8.0% 26.2 11.40sec 1916768 1938509 Direct 26.2 88256 249828 208060 74.1%  
Periodic 301.7 48163 185508 148514 73.1% 133.1%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.23 26.23 301.73 301.73 0.9888 1.3232 50269424.21 50269424.21 0.00 118228.42 1938509.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.78 25.85% 88256.37 78852 98528 88163.86 0 96614 598323 598323 0.00
crit 19.45 74.15% 249828.47 218264 272724 249639.17 233625 263088 4858265 4858265 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.3 26.93% 48163.46 74 54191 48148.50 44015 51078 3913855 3913855 0.00
crit 220.5 73.07% 185507.95 127 210001 185417.50 170920 195064 40898981 40898981 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14533 0.7% 5.1 60.37sec 851942 0 Periodic 48.0 73504 149546 90925 22.9% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.12 0.00 47.99 47.99 0.0000 1.2509 4363989.90 4363989.90 0.00 72693.18 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.0 77.09% 73503.51 114 76542 73498.04 69465 76542 2719371 2719371 0.00
crit 11.0 22.91% 149546.30 465 156146 149520.03 115516 156146 1644619 1644619 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 59406 (133130) 2.8% (6.3%) 7.5 28.80sec 5248796 4354675 Direct 36.0 352566 972441 489191 22.0%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.51 35.95 0.00 0.00 1.2054 0.0000 17587342.65 17587342.65 0.00 4354674.63 4354674.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.03 77.96% 352566.32 172248 908617 353259.10 216370 528657 9882223 9882223 0.00
crit 7.92 22.04% 972440.59 476784 2515052 973122.00 497825 2217126 7705120 7705120 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 73723 3.5% 11.0 40.50sec 1984371 0 Direct 54.0 290361 802037 404053 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.99 53.98 0.00 0.00 0.0000 0.0000 21813753.44 21813753.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.98 77.78% 290361.09 144687 763232 290957.08 180147 585449 12191834 12191834 0.00
crit 12.00 22.22% 802037.02 400495 2112627 805820.56 445471 2112627 9621920 9621920 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Heavy_Spear1
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 162640 (262570) 7.7% (12.5%) 55.5 5.32sec 1414326 1200045 Direct 55.5 253506 876112 876069 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.53 55.53 0.00 0.00 1.1786 0.0000 48651902.90 48651902.90 0.00 1200045.37 1200045.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 253505.60 229983 276204 982.23 0 276204 982 982 0.00
crit 55.53 99.99% 876111.97 750443 1207773 876678.89 838089 925662 48650921 48650921 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 81185 3.9% 35.2 8.35sec 689688 0 Direct 35.2 209114 689722 689691 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.22 35.22 0.00 0.00 0.0000 0.0000 24290183.72 24290183.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 209113.87 193186 219445 478.77 0 219445 479 479 0.00
crit 35.22 99.99% 689722.31 590994 951153 690202.33 652521 745077 24289705 24289705 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18745 0.9% 41.5 6.68sec 135086 0 Direct 95.0 47030 95892 58952 24.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.47 95.03 0.00 0.00 0.0000 0.0000 5602082.78 5602082.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.85 75.60% 47029.93 44808 50897 47028.14 44808 50123 3378855 3378855 0.00
crit 23.18 24.40% 95892.18 91408 103831 95907.42 91408 103831 2223227 2223227 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 41732 (81588) 2.0% (3.9%) 38.3 7.66sec 640150 504094 Direct 38.3 227915 615989 327554 25.7%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.33 38.33 0.00 0.00 1.2699 0.0000 12554121.30 12554121.30 0.00 504093.98 504093.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.48 74.32% 227915.14 156284 585841 229003.11 173156 395858 6492889 6492889 0.00
crit 9.84 25.68% 615988.87 432595 1621608 617342.58 0 1490565 6061232 6061232 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 39856 1.9% 43.3 9.11sec 276877 0 Direct 43.3 192165 521062 276861 25.7%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.27 43.27 0.00 0.00 0.0000 0.0000 11980132.77 11980132.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.13 74.25% 192164.63 131279 492107 192657.42 141289 326204 6174340 6174340 0.00
crit 11.14 25.75% 521062.49 363380 1362151 521335.48 375493 1062713 5805793 5805793 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45734 (67200) 2.2% (3.2%) 3.0 120.33sec 6695697 0 Direct 94.6 116064 236771 143940 23.1%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.99 94.60 94.60 0.00 0.0000 0.6134 13616890.93 13616890.93 0.00 344715.74 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.75 76.91% 116064.33 116064 116064 116064.33 116064 116064 8444119 8444119 0.00
crit 21.85 23.09% 236771.23 236771 236771 236771.23 236771 236771 5172772 5172772 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21466 1.0% 38.0 6.91sec 168194 0 Direct 38.0 135409 276235 168199 23.3%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.98 37.98 0.00 0.00 0.0000 0.0000 6387652.83 6387652.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.14 76.72% 135409.19 135409 135409 135409.19 135409 135409 3945325 3945325 0.00
crit 8.84 23.28% 276234.76 276235 276235 276234.76 276235 276235 2442328 2442328 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 133910 / 85861
Fire Blast 133910 4.1% 96.7 2.99sec 265152 136367 Direct 96.7 213208 426453 265165 24.4%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.72 96.72 0.00 0.00 1.9444 0.0000 25646491.16 25646491.16 0.00 136366.73 136366.73
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.16 75.64% 213208.08 201607 229011 213259.71 207743 220135 15598749 15598749 0.00
crit 23.56 24.36% 426453.03 403214 458023 426540.08 412655 445265 10047742 10047742 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 177575 / 24087
Lightning Blast 177575 1.1% 37.7 7.49sec 191818 194705 Direct 37.7 156714 313664 191819 22.4%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.68 37.68 0.00 0.00 0.9852 0.0000 7227060.67 7227060.67 0.00 194705.01 194705.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.25 77.63% 156714.11 149339 169638 156759.79 150920 166322 4583858 4583858 0.00
crit 8.43 22.37% 313663.58 298677 339276 313707.57 0 339276 2643202 2643202 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
mb_lvs
Ascendance 2.0 181.91sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 106.78sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.46 0.00 0.00 0.00 1.0430 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:mb_lvs
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.25sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.16 0.00 0.00 0.00 0.8312 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.65sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.03 0.00 0.00 0.00 0.5057 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 14.72% 0.0(0.0) 2.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 24.9sec 32.29% 32.29% 3.1(3.1) 8.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.5 1.3 29.8sec 26.0sec 31.38% 31.38% 1.3(1.3) 9.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.6 1.3 29.6sec 25.6sec 31.52% 31.52% 1.3(1.3) 9.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.2 1.6 30.6sec 25.6sec 30.50% 30.50% 1.6(1.6) 8.9

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 75.5 34.6 4.0sec 2.7sec 77.45% 71.83% 34.6(34.6) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.82%
  • elemental_focus_2:57.64%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 19.18% 19.18% 0.0(0.0) 4.7

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 23.3 6.7 12.4sec 9.5sec 25.32% 41.95% 6.8(6.8) 1.3

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.32%

Trigger Attempt Success

  • trigger_pct:99.87%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.0sec 17.0sec 29.82% 29.82% 4.3(4.3) 12.6

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.8sec 85.8sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:78.60%
Potion of Prolonged Power 2.0 0.0 90.9sec 0.0sec 39.88% 39.88% 0.0(0.0) 2.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.0 2.4 47.1sec 32.4sec 31.67% 39.20% 2.4(5.8) 2.2

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.97%
  • power_of_the_maelstrom_2:7.42%
  • power_of_the_maelstrom_3:18.28%

Trigger Attempt Success

  • trigger_pct:15.13%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 4.9 0.0 46.4sec 46.4sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:10.04%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.9sec 62.2sec 11.77% 9.73% 0.0(0.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.31%
  • stormkeeper_2:3.78%
  • stormkeeper_3:3.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.11% 2.0(2.0) 0.0

Buff details

  • buff initial source:mb_lvs
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 30.1 9.5sec
Lava Surge: Wasted 6.9 32.1sec
Lava Surge: During Lava Burst 4.3 54.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.5720.00117.22715.9970.18520.281
Fire Elemental0.5020.0011.6720.6190.0003.329
Ascendance2.1440.0019.0731.9140.0009.073
Lava Burst3.0040.00136.02244.6458.38399.764
Elemental Blast2.1370.00121.61635.97019.16160.753

Resources

Resource Usage Type Count Total Average RPE APR
mb_lvs
earth_shock Maelstrom 72.9 8662.9 118.8 911.7 2197.9
earthquake Maelstrom 370.2 18510.9 50.0 383.7 11411.3
flame_shock Maelstrom 201.2 3808.0 18.9 145.2 13201.0
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 426.15 5058.62 (16.14%) 11.87 55.21 1.08%
Lava Burst Overload Maelstrom 270.25 2369.30 (7.56%) 8.77 62.95 2.59%
Lava Beam Maelstrom 57.60 1613.06 (5.15%) 28.00 42.29 2.55%
Lava Beam Overload Maelstrom 84.35 1578.32 (5.04%) 18.71 78.51 4.74%
Chain Lightning Maelstrom 321.97 7533.95 (24.04%) 23.40 136.48 1.78%
Chain Lightning Overload Maelstrom 392.99 6606.46 (21.08%) 16.81 384.94 5.51%
Lightning Bolt Maelstrom 294.09 2343.82 (7.48%) 7.97 8.91 0.38%
Lightning Bolt Overload Maelstrom 332.02 1973.11 (6.30%) 5.94 19.03 0.96%
Resonance Totem Maelstrom 2291.48 2262.19 (7.22%) 0.99 29.28 1.28%
Resource RPS-Gain RPS-Loss
Maelstrom 13.61 13.46
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 46.33 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data mb_lvs Fight Length
Count 5678
Mean 300.00
Minimum 239.99
Maximum 359.98
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.00%
Standard Deviation 34.8570
5th Percentile 246.40
95th Percentile 353.59
( 95th Percentile - 5th Percentile ) 107.20
Mean Distribution
Standard Deviation 0.4626
95.00% Confidence Intervall ( 299.09 - 300.90 )
Normalized 95.00% Confidence Intervall ( 99.70% - 100.30% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 519
0.1% Error 51862
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1038
DPS
Sample Data mb_lvs Damage Per Second
Count 5678
Mean 2104417.10
Minimum 1788080.49
Maximum 2555105.35
Spread ( max - min ) 767024.85
Range [ ( max - min ) / 2 * 100% ] 18.22%
Standard Deviation 97027.8238
5th Percentile 1950574.01
95th Percentile 2267175.12
( 95th Percentile - 5th Percentile ) 316601.11
Mean Distribution
Standard Deviation 1287.6523
95.00% Confidence Intervall ( 2101893.34 - 2106940.85 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 82
0.1% Error 8167
0.1 Scale Factor Error with Delta=300 80366722
0.05 Scale Factor Error with Delta=300 321466885
0.01 Scale Factor Error with Delta=300 8036672119
Priority Target DPS
Sample Data mb_lvs Priority Target Damage Per Second
Count 5678
Mean 1034636.78
Minimum 906268.15
Maximum 1221428.45
Spread ( max - min ) 315160.30
Range [ ( max - min ) / 2 * 100% ] 15.23%
Standard Deviation 39846.2523
5th Percentile 970975.54
95th Percentile 1102417.90
( 95th Percentile - 5th Percentile ) 131442.37
Mean Distribution
Standard Deviation 528.7980
95.00% Confidence Intervall ( 1033600.36 - 1035673.21 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 57
0.1% Error 5698
0.1 Scale Factor Error with Delta=300 13553724
0.05 Scale Factor Error with Delta=300 54214895
0.01 Scale Factor Error with Delta=300 1355372375
DPS(e)
Sample Data mb_lvs Damage Per Second (Effective)
Count 5678
Mean 2104417.10
Minimum 1788080.49
Maximum 2555105.35
Spread ( max - min ) 767024.85
Range [ ( max - min ) / 2 * 100% ] 18.22%
Damage
Sample Data mb_lvs Damage
Count 5678
Mean 597436101.04
Minimum 431697139.54
Maximum 793352027.25
Spread ( max - min ) 361654887.71
Range [ ( max - min ) / 2 * 100% ] 30.27%
DTPS
Sample Data mb_lvs Damage Taken Per Second
Count 5678
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data mb_lvs Healing Per Second
Count 5678
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data mb_lvs Healing Per Second (Effective)
Count 5678
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data mb_lvs Heal
Count 5678
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data mb_lvs Healing Taken Per Second
Count 5678
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data mb_lvs Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data mb_lvsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data mb_lvs Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 0.98 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 1.98 totem_mastery,if=buff.resonance_totem.remains<2
9 3.38 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.93 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 3.83 stormkeeper
G 0.18 ascendance
0.00 liquid_magma_totem
H 1.92 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 47.15 earthquake
J 1.55 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.65 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.33 lava_beam
M 34.04 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.15 lava_burst,moving=1
O 0.08 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.77 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 5.91 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.75 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 17.96 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.31 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.26 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.12 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 52.90 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 15.82 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.65 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.01 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 13.23 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 7.64 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 22.75 lightning_bolt
e 0.15 flame_shock,moving=1,target_if=refreshable
f 0.33 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWWRdddPWWWTWWWILLIILAILIMSWWXXbWbWYWWXbXSWXbbWWIIMMIIIMSWWXXXbcWWWSTcWQWFM97IMIAMIMSWWXdWddTWdSddQWIMMIIMIMSWW8WXAXddWdSWTWQWMFIMMIAIMISWWXddddWdTSddQWMIIMMINISWdRWdWWb9YPWSWWWILIFLIIAIMIIJKMWbbbIIJMMIIKMMIIIMIMMI8KMIAMMMIMMQWSfWMIMFIMAIISWWcdWWTdddSQWWdIMIMIMIMSWWd

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation mb_lvs 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.058 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.874 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.939 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.005 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_mastery, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.070 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.870 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom bloodlust, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.670 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.469 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_blast_mastery, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.287 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.287 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, ascendance, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.373 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom bloodlust, ascendance, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.459 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.545 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.361 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom bloodlust, ascendance, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.447 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.531 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.616 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.432 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.519 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.603 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.418 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:20.233 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.321 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.321 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:22.138 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:23.223 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.039 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.125 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.212 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom bloodlust, lava_surge, elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.990 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.028 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.806 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.585 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.622 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:31.385 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:32.400 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:33.163 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:33.925 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:34.689 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.706 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.469 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom bloodlust, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:37.556 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:38.372 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 18.0/125: 14% maelstrom bloodlust, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:39.459 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom bloodlust, lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:40.275 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom bloodlust, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:41.054 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:42.401 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:43.750 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:44.761 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:46.108 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:47.101 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:48.092 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:49.413 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.732 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:51.771 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.831 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.890 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.302 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.713 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.771 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.184 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.244 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.305 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.364 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.776 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.188 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.248 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.656 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.715 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.127 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.185 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.532 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.543 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.554 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.902 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.914 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.926 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.010 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.010 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:20.021 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:21.032 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:22.090 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:22.090 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:23.129 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:24.167 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:25.550 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:26.934 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.925 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.245 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:30.236 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:31.558 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:32.549 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.894 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.239 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:36.250 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:37.597 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.008 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.419 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.767 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:43.114 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:44.125 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:45.471 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:46.480 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.826 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.174 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.186 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.197 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.608 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.669 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.080 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.491 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.551 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.962 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.716 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:00.775 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.834 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.834 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.896 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.307 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:05.719 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.130 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.0/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.541 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.951 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.010 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:12.069 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.128 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:14.165 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:15.548 aoe M chain_lightning Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:16.932 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:17.971 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:19.010 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:20.049 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.109 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.168 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:22.168 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.227 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.285 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.345 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.756 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom lava_surge, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.766 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.111 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.121 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.468 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.814 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.160 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.505 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:36.852 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.0/125: 86% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:38.263 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:39.324 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:40.735 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:42.147 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:43.558 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:44.618 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:46.027 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:47.437 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.495 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.554 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.965 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.377 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.437 aoe N lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom movement, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.497 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.555 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.967 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.314 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.633 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.626 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:01.618 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:02.940 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.930 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.251 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.598 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.587 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.626 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.626 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.010 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:11.393 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 16.0/125: 13% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.431 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.777 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.122 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom ascendance, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.133 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.480 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.490 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.500 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.846 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.856 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.916 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.916 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.976 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.035 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom lava_surge, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.095 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.152 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.210 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.620 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.678 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.091 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.504 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.915 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.327 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:37.386 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.445 aoe J lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.505 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:40.888 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:42.271 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:43.310 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:44.350 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:45.735 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:47.056 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.401 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.411 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.421 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.432 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.778 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.789 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.135 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.482 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.541 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.297 aoe K elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.709 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.119 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.178 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.178 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/125: 2% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.590 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.001 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:06.384 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:07.421 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:08.803 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.189 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.228 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.612 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.650 single_asc f earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom movement, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.709 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.121 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.532 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.591 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.003 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.064 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.121 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.182 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.182 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.241 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.301 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.713 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/125: 3% maelstrom lava_surge, elemental_blast_critical_strike, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:27.772 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:29.185 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.246 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:31.305 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.363 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:33.773 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/125: 96% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.833 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.243 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:37.656 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:39.068 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:40.479 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:41.539 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:42.597 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:44.007 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:45.416 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:46.475 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:47.884 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.944 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.353 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.413 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:52.796 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:53.834 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/125: 4% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:55.218 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:56.603 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:57.985 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.399 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="mb_lvs"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:7:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

tgt_eq : 2156021 dps, 1032768 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
2156021.4 2156021.4 2585.3 / 0.120% 405040.5 / 18.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.01% 54.0 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Ancestral Swiftness
  • 75: Elemental Blast (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
tgt_eq 2156021
Chain Lightning 189155 (411539) 8.8% (19.2%) 42.1 6.35sec 2938552 2250707 Direct 167.0 242424 659330 340614 23.6%  

Stats details: chain_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.11 166.99 0.00 0.00 1.3056 0.0000 56879082.10 56879082.10 0.00 2250707.06 2250707.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.66 76.45% 242423.82 149101 558915 243043.29 164945 304735 30946929 30946929 0.00
crit 39.33 23.55% 659329.58 412712 1547076 661313.70 451345 961522 25932153 25932153 0.00
 
 

Action details: chain_lightning

Static Values
  • id:188443
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188443
  • name:Chain Lightning
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets. |cFFFFFFFFGenerates {$s2=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Chain Lightning Overload 222384 10.4% 51.1 9.50sec 1308748 0 Direct 227.4 209126 570349 294043 23.5%  

Stats details: chain_lightning_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.09 227.41 0.00 0.00 0.0000 0.0000 66867042.97 66867042.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.94 76.49% 209126.31 125245 469488 209339.30 136967 312963 36374626 36374626 0.00
crit 53.46 23.51% 570349.07 346678 1299544 571474.86 370100 896492 30492417 30492417 0.00
 
 

Action details: chain_lightning_overload

Static Values
  • id:45297
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45297
  • name:Chain Lightning Overload
  • school:nature
  • tooltip:
  • description:Hurls a lightning bolt at the enemy, dealing {$s1=1} Nature damage and then jumping to additional nearby enemies. Affects $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.648000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Earth Shock 63231 2.9% 9.5 31.65sec 1996042 2026976 Direct 9.5 1377893 3821361 1995877 25.3%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.51 9.51 0.00 0.00 0.9848 0.0000 18980607.50 18980607.50 0.00 2026976.45 2026976.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.10 74.70% 1377892.56 103593 1618024 1379792.52 881472 1618024 9787608 9787608 0.00
crit 2.41 25.30% 3821360.90 315421 4478691 3528411.85 0 4478691 9193000 9193000 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.845000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Earthquake 0 (771013) 0.0% (35.8%) 48.3 5.81sec 4779865 4735756

Stats details: earthquake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 48.35 0.00 0.00 0.00 1.0093 0.0000 0.00 0.00 0.00 4735756.24 4735756.24
 
 

Action details: earthquake

Static Values
  • id:61882
  • school:nature
  • resource:maelstrom
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:61882
  • name:Earthquake
  • school:nature
  • tooltip:
  • description:Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.
 
    Earthquake (_) 581771 27.0% 286.9 0.97sec 607796 0 Direct 1468.0 85041 235409 118782 22.4%  

Stats details: earthquake_

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 286.89 1467.95 0.00 0.00 0.0000 0.0000 174368157.35 174368157.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1138.55 77.56% 85041.25 75849 94775 85072.31 81208 89475 96823741 96823741 0.00
crit 329.40 22.44% 235408.82 209950 262336 235498.17 225761 247284 77544416 77544416 0.00
 
 

Action details: earthquake_

Static Values
  • id:77478
  • school:physical
  • resource:none
  • range:35.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77478
  • name:Earthquake
  • school:physical
  • tooltip:
  • description:{$@spelldesc61882=Causes the earth within $a1 yards of the target location to tremble and break, dealing $<damage> Physical damage over {$d=6 seconds} and sometimes knocking down enemies.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.775000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Seismic Lightning 189242 8.8% 73.4 4.35sec 772750 0 Direct 73.4 553311 1531471 772732 22.4%  

Stats details: seismic_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.40 73.40 0.00 0.00 0.0000 0.0000 56717804.22 56717804.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.93 77.57% 553311.14 527760 599497 553432.93 535879 580108 31501132 31501132 0.00
crit 16.47 22.43% 1531470.89 1460840 1659409 1531787.29 1460840 1624297 25216672 25216672 0.00
 
 

Action details: seismic_lightning

Static Values
  • id:243073
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243073
  • name:Seismic Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc238141=Earthquake damage has a {$h=5}% chance to cause Seismic Lightning, dealing {$243073s1=0} Nature damage to the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Elemental Blast 57065 (87289) 2.7% (4.1%) 19.9 15.27sec 1312691 968423 Direct 19.9 596508 1653549 858210 24.8%  

Stats details: elemental_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.94 19.94 0.00 0.00 1.3555 0.0000 17113559.23 17113559.23 0.00 968423.48 968423.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.00 75.24% 596508.25 528062 659824 596666.16 563221 630947 8948706 8948706 0.00
crit 4.94 24.76% 1653549.33 1461674 1826393 1647923.67 0 1826393 8164853 8164853 0.00
 
 

Action details: elemental_blast

Static Values
  • id:117014
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:117014
  • name:Elemental Blast
  • school:elemental
  • tooltip:
  • description:Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
    Elemental Blast Overload 30224 1.4% 12.6 23.21sec 720833 0 Direct 12.6 501088 1388544 720752 24.8%  

Stats details: elemental_blast_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.57 12.57 0.00 0.00 0.0000 0.0000 9060990.66 9060990.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.46 75.24% 501088.32 443572 554252 501196.06 466881 548869 4739097 4739097 0.00
crit 3.11 24.76% 1388543.69 1227806 1534170 1331716.83 0 1534170 4321894 4321894 0.00
 
 

Action details: elemental_blast_overload

Static Values
  • id:120588
  • school:elemental
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120588
  • name:Elemental Blast Overload
  • school:elemental
  • tooltip:
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:7.004000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 167347 7.8% 26.0 11.50sec 1923138 1944796 Direct 26.0 88215 249843 207826 74.0%  
Periodic 300.6 48143 185493 148501 73.1% 132.6%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.03 26.03 300.62 300.62 0.9889 1.3231 50051270.64 50051270.64 0.00 118184.26 1944796.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.77 26.00% 88214.81 78852 98528 88109.54 0 95976 596854 596854 0.00
crit 19.26 74.00% 249842.90 218264 272724 249655.98 233062 263440 4811902 4811902 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.0 26.93% 48143.49 34 54191 48124.23 43675 50996 3898144 3898144 0.00
crit 219.7 73.07% 185492.75 94 210001 185394.70 172931 197060 40744371 40744371 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast1
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.824000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.412000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14526 0.7% 5.1 60.37sec 850174 0 Periodic 48.0 73523 149472 90873 22.8% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.13 0.00 47.99 47.99 0.0000 1.2510 4361106.86 4361106.86 0.00 72643.95 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.0 77.15% 73522.68 116 76542 73516.22 70013 76542 2722294 2722294 0.00
crit 11.0 22.85% 149471.90 3560 156146 149460.67 94997 156146 1638813 1638813 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:62801.17
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Beam 59456 (133822) 2.7% (6.1%) 7.5 28.83sec 5279077 4380310 Direct 35.9 352093 976014 489432 22.0%  

Stats details: lava_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.50 35.94 0.00 0.00 1.2053 0.0000 17587618.08 17587618.08 0.00 4380309.80 4380309.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.03 77.99% 352092.94 172248 908617 352866.19 221794 547076 9867030 9867030 0.00
crit 7.91 22.01% 976014.06 476784 2515052 975022.14 0 2286411 7720588 7720588 0.00
 
 

Action details: lava_beam

Static Values
  • id:114074
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:114074
  • name:Lava Beam
  • school:fire
  • tooltip:
  • description:Unleashes a blast of superheated flame at the enemy, dealing {$s1=0 to 2} Fire damage and then jumping to additional nearby enemies. Damage is increased by {$s2=10}% after each jump. Affects $x1 total targets. |cFFFFFFFFGenerates {$s3=6} Maelstrom per target hit.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:2.00
 
    Lava Beam Overload 74366 3.4% 11.0 40.53sec 1991494 0 Direct 54.2 291061 805938 405551 22.2%  

Stats details: lava_beam_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.05 54.25 0.00 0.00 0.0000 0.0000 22001621.91 22001621.91 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.19 77.76% 291060.82 144687 763232 291675.26 177180 558238 12279379 12279379 0.00
crit 12.06 22.24% 805938.21 400495 2112627 809492.64 461032 2112627 9722243 9722243 0.00
 
 

Action details: lava_beam_overload

Static Values
  • id:114738
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow_Pack_Beast5
  • harmful:true
  • if_expr:
Spelldata
  • id:114738
  • name:Lava Beam Overload
  • school:fire
  • tooltip:
  • description:Unleash a blast of superheated flame at the enemy, dealing {$s1=0} Fire damage and then jumping to additional nearby enemies. Affects up to $x1 total targets.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.980000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Lava Burst 151727 (248410) 7.0% (11.5%) 55.4 5.33sec 1340610 1137237 Direct 55.4 252657 818926 818890 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 55.43 55.43 0.00 0.00 1.1788 0.0000 45390568.61 45390568.61 0.00 1137237.02 1137237.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 252656.72 229983 276204 897.54 0 276204 898 898 0.00
crit 55.43 99.99% 818926.11 701650 1129245 819473.17 785093 860368 45389671 45389671 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 77895 3.6% 35.3 8.29sec 661166 0 Direct 35.3 213770 661197 661169 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.25 35.25 0.00 0.00 0.0000 0.0000 23308212.13 23308212.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.00 0.01% 213769.82 193186 241389 483.25 0 241389 483 483 0.00
crit 35.25 99.99% 661197.36 566884 912350 661659.78 622340 711536 23307729 23307729 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.832500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 18788 0.9% 41.3 6.57sec 135984 0 Direct 95.1 47043 95911 58987 24.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.26 95.12 0.00 0.00 0.0000 0.0000 5610560.33 5610560.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.87 75.56% 47042.95 44808 50897 47041.69 44808 50171 3381032 3381032 0.00
crit 23.25 24.44% 95911.00 91408 103831 95901.96 0 103831 2229529 2229529 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.618000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 41928 (81754) 2.0% (3.8%) 38.4 7.64sec 640722 504366 Direct 38.4 227722 616845 328688 25.9%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.37 38.37 0.00 0.00 1.2704 0.0000 12610272.33 12610272.33 0.00 504365.85 504365.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.41 74.05% 227721.78 156284 585841 228858.13 170903 370000 6470135 6470135 0.00
crit 9.95 25.95% 616845.08 432595 1621608 618295.68 447015 1621608 6140137 6140137 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 39825 1.9% 43.3 9.07sec 276808 0 Direct 43.3 192390 520364 276816 25.7%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.25 43.25 0.00 0.00 0.0000 0.0000 11972014.86 11972014.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.12 74.26% 192389.96 131279 492107 192930.97 142049 339465 6178940 6178940 0.00
crit 11.13 25.74% 520364.02 363380 1362151 521055.53 0 1252075 5793075 5793075 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.802500
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 45646 (67096) 2.1% (3.1%) 3.0 120.34sec 6705444 0 Direct 94.5 116064 236771 143830 23.0%  

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.98 94.50 94.50 0.00 0.0000 0.6134 13592749.36 13592749.36 0.00 344657.70 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.76 77.00% 116064.33 116064 116064 116064.33 116064 116064 8445221 8445221 0.00
crit 21.74 23.00% 236771.23 236771 236771 236771.23 236771 236771 5147528 5147528 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:95227.92
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 21450 1.0% 38.0 6.89sec 168140 0 Direct 38.0 135409 276235 168140 23.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.97 37.97 0.00 0.00 0.0000 0.0000 6384989.79 6384989.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.15 76.76% 135409.19 135409 135409 135409.19 135409 135409 3946960 3946960 0.00
crit 8.83 23.24% 276234.76 276235 276235 276145.55 0 276235 2438029 2438029 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=28166 to 31131} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=32861 to 36320} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:105545.44
  • base_dd_max:116655.49
 
pet - primal_fire_elemental 134027 / 85882
Fire Blast 134027 4.0% 96.7 2.98sec 265342 136469 Direct 96.7 213179 426409 265338 24.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.67 96.67 0.00 0.00 1.9443 0.0000 25651896.44 25651896.44 0.00 136469.49 136469.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.03 75.54% 213179.00 201607 229011 213231.29 207657 220526 15567406 15567406 0.00
crit 23.65 24.46% 426408.72 403214 458023 426514.83 411303 446100 10084490 10084490 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.781000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
pet - greater_lightning_elemental 177521 / 24112
Lightning Blast 177521 1.1% 37.7 7.49sec 191770 194613 Direct 37.7 156718 313585 191771 22.3%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.72 37.72 0.00 0.00 0.9854 0.0000 7232992.53 7232992.53 0.00 194613.16 194613.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.29 77.66% 156717.94 149339 169638 156762.51 151192 166343 4590199 4590199 0.00
crit 8.43 22.34% 313585.45 298677 339276 313688.67 298677 339276 2642794 2642794 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.060000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
tgt_eq
Ascendance 2.0 181.98sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
Fire Elemental 3.5 106.73sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.45 0.00 0.00 0.00 1.0432 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:tgt_eq
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.2 62.17sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.17 0.00 0.00 0.00 0.8315 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 118.65sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.04 0.00 0.00 0.00 0.5062 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 2.0 0.0 181.9sec 181.9sec 10.14% 14.75% 0.0(0.0) 2.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.52% 13.52% 0.0(0.0) 1.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.2 3.1 35.5sec 25.0sec 32.02% 32.02% 3.1(3.1) 7.9

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:5200.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Critical Strike 9.5 1.3 29.9sec 25.9sec 31.31% 31.31% 1.3(1.3) 9.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_critical_strike
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_critical_strike_1:31.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:118522
  • name:Elemental Blast: Critical Strike
  • tooltip:Critical Strike increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Haste 9.5 1.3 29.6sec 25.7sec 31.39% 31.39% 1.3(1.3) 9.2

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_haste
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_haste_1:31.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173183
  • name:Elemental Blast: Haste
  • tooltip:Haste increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Blast: Mastery 9.3 1.6 30.6sec 25.6sec 30.50% 30.50% 1.6(1.6) 8.9

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_blast_mastery
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:2400.00

Stack Uptimes

  • elemental_blast_mastery_1:30.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:173184
  • name:Elemental Blast: Mastery
  • tooltip:Mastery increased by {$s1=2400}.
  • description:{$@spelldesc117014=Harnesses the raw power of the elements, dealing {$s1=0} Elemental damage and increasing your Critical Strike, Haste, or Mastery by {$118522s1=2400} for {$118522d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 75.5 34.5 4.0sec 2.7sec 77.37% 71.76% 34.5(34.5) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:19.77%
  • elemental_focus_2:57.61%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.0sec 60.0sec 19.18% 19.18% 0.0(0.0) 4.7

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Lava Surge 23.3 6.8 12.4sec 9.5sec 25.39% 41.98% 6.8(6.8) 1.3

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:25.39%

Trigger Attempt Success

  • trigger_pct:99.87%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.77% 29.77% 4.2(4.2) 12.6

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
movement 1.5 0.0 85.1sec 85.1sec 0.35% 0.35% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • movement_1:0.35%

Trigger Attempt Success

  • trigger_pct:77.89%
Potion of Prolonged Power 2.0 0.0 91.1sec 0.0sec 39.88% 39.88% 0.0(0.0) 2.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 6.0 2.3 47.1sec 32.7sec 31.25% 39.14% 2.3(5.6) 2.1

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:5.98%
  • power_of_the_maelstrom_2:7.33%
  • power_of_the_maelstrom_3:17.94%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 300.7(300.7) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Static Overload 4.9 0.0 47.0sec 47.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_static_overload
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:10.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:9.94%

Spelldata details

  • id:191634
  • name:Static Overload
  • tooltip:
  • description:{$@spelldesc191602=Chain Lightning has a {$s1=10}% chance to cause Elemental Overload to trigger on every target.}
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 118.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.2 0.0 64.9sec 62.2sec 11.77% 9.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:4.29%
  • stormkeeper_2:3.79%
  • stormkeeper_3:3.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 118.6sec 100.00% 98.10% 2.0(2.0) 0.0

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (lavish_suramar_feast)

Buff details

  • buff initial source:tgt_eq
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval
Lava Surge 30.1 9.5sec
Lava Surge: Wasted 6.9 32.0sec
Lava Surge: During Lava Burst 4.3 54.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper4.5780.00117.44716.0020.00020.294
Fire Elemental0.5090.0011.7940.6230.0003.684
Ascendance2.1370.0028.7641.9250.0008.764
Lava Burst3.0150.00137.70444.7919.44495.212
Elemental Blast2.1380.00119.42636.12717.60661.453

Resources

Resource Usage Type Count Total Average RPE APR
tgt_eq
earth_shock Maelstrom 73.1 8678.1 118.8 912.6 2187.2
earthquake Maelstrom 371.5 18575.0 50.0 384.2 12440.7
flame_shock Maelstrom 200.0 3783.3 18.9 145.4 13229.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 425.94 5056.64 (16.10%) 11.87 54.64 1.07%
Lava Burst Overload Maelstrom 270.89 2374.84 (7.56%) 8.77 63.13 2.59%
Lava Beam Maelstrom 57.62 1612.31 (5.13%) 27.98 44.62 2.69%
Lava Beam Overload Maelstrom 84.87 1588.75 (5.06%) 18.72 78.35 4.70%
Chain Lightning Maelstrom 323.59 7561.85 (24.08%) 23.37 137.15 1.78%
Chain Lightning Overload Maelstrom 392.64 6616.14 (21.07%) 16.85 374.37 5.36%
Lightning Bolt Maelstrom 294.77 2348.97 (7.48%) 7.97 9.16 0.39%
Lightning Bolt Overload Maelstrom 332.32 1974.30 (6.29%) 5.94 19.64 0.98%
Resonance Totem Maelstrom 2294.64 2265.09 (7.21%) 0.99 29.56 1.29%
Resource RPS-Gain RPS-Loss
Maelstrom 13.62 13.46
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 47.02 0.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data tgt_eq Fight Length
Count 6193
Mean 300.01
Minimum 239.97
Maximum 360.05
Spread ( max - min ) 120.08
Range [ ( max - min ) / 2 * 100% ] 20.01%
Standard Deviation 35.0096
5th Percentile 245.56
95th Percentile 354.40
( 95th Percentile - 5th Percentile ) 108.84
Mean Distribution
Standard Deviation 0.4449
95.00% Confidence Intervall ( 299.13 - 300.88 )
Normalized 95.00% Confidence Intervall ( 99.71% - 100.29% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 524
0.1% Error 52314
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 42
0.01 Scale Factor Error with Delta=300 1047
DPS
Sample Data tgt_eq Damage Per Second
Count 6193
Mean 2156021.35
Minimum 1803259.80
Maximum 2611262.45
Spread ( max - min ) 808002.65
Range [ ( max - min ) / 2 * 100% ] 18.74%
Standard Deviation 103804.5171
5th Percentile 1994154.50
95th Percentile 2333670.08
( 95th Percentile - 5th Percentile ) 339515.58
Mean Distribution
Standard Deviation 1319.0635
95.00% Confidence Intervall ( 2153436.04 - 2158606.67 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 90
0.1% Error 8905
0.1 Scale Factor Error with Delta=300 91984823
0.05 Scale Factor Error with Delta=300 367939290
0.01 Scale Factor Error with Delta=300 9198482228
Priority Target DPS
Sample Data tgt_eq Priority Target Damage Per Second
Count 6193
Mean 1032767.64
Minimum 908870.42
Maximum 1178898.10
Spread ( max - min ) 270027.68
Range [ ( max - min ) / 2 * 100% ] 13.07%
Standard Deviation 39905.1485
5th Percentile 968465.93
95th Percentile 1101040.07
( 95th Percentile - 5th Percentile ) 132574.14
Mean Distribution
Standard Deviation 507.0822
95.00% Confidence Intervall ( 1031773.78 - 1033761.51 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 58
0.1% Error 5736
0.1 Scale Factor Error with Delta=300 13593821
0.05 Scale Factor Error with Delta=300 54375283
0.01 Scale Factor Error with Delta=300 1359382055
DPS(e)
Sample Data tgt_eq Damage Per Second (Effective)
Count 6193
Mean 2156021.35
Minimum 1803259.80
Maximum 2611262.45
Spread ( max - min ) 808002.65
Range [ ( max - min ) / 2 * 100% ] 18.74%
Damage
Sample Data tgt_eq Damage
Count 6193
Mean 612858228.93
Minimum 438881659.07
Maximum 813862522.48
Spread ( max - min ) 374980863.41
Range [ ( max - min ) / 2 * 100% ] 30.59%
DTPS
Sample Data tgt_eq Damage Taken Per Second
Count 6193
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data tgt_eq Healing Per Second
Count 6193
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data tgt_eq Healing Per Second (Effective)
Count 6193
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data tgt_eq Heal
Count 6193
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data tgt_eq Healing Taken Per Second
Count 6193
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data tgt_eq Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data tgt_eqTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data tgt_eq Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.07 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 2.16 totem_mastery,if=buff.resonance_totem.remains<2
9 3.68 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.64 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.aoe
# count action,conditions
F 4.19 stormkeeper
G 0.18 ascendance
0.00 liquid_magma_totem
H 2.09 flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
I 51.53 earthquake
J 1.68 lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
K 1.82 elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
L 7.99 lava_beam
M 37.16 chain_lightning,target_if=debuff.lightning_rod.down
0.00 chain_lightning
N 0.16 lava_burst,moving=1
O 0.09 flame_shock,moving=1,target_if=refreshable
actions.single_asc
# count action,conditions
P 1.95 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
Q 6.47 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
R 1.93 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
S 19.55 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
T 7.97 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
U 0.27 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
V 2.34 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
W 57.60 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
X 17.00 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
Y 1.79 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
Z 0.01 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
a 0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
b 14.41 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
c 8.42 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
d 24.87 lightning_bolt
e 0.17 flame_shock,moving=1,target_if=refreshable
f 0.37 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AQSWVRVVWWPWTWWWWILILLILAILIMSWWXXbbbfbWWXXcSccWXIMMIIMIMSWWXXbbbWbTSbbdQWFIMIMIAIMISW97WXccWHHHMSWbbIIMIMIIMISW8WdAdddWdYSddQWMFIMIIAMIMSWcTWdddddSWTWQcMIIMIIIMRSWWddddWTWPWSWWW9ILFILAILSVWWWYbQbWbWSWTccIMIMIIMMS8WWTAdQddWdSdddWIIMIFIAMIMSWVWbQYbWbbSbcWIIMIIMIIISWWW

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation tgt_eq 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.059 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.876 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:02.943 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, elemental_blast_mastery, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.010 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.810 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.608 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.408 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.208 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:08.007 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:09.072 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.072 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.160 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.975 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.062 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.149 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, ascendance, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.233 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.050 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.868 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.955 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.771 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.858 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.947 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.763 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.850 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.850 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.649 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.714 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.514 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.580 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.646 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.445 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.459 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.221 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.984 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.999 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.016 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.004 single_asc f earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom bloodlust, movement, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.768 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.786 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 9.0/125: 7% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.802 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom bloodlust, lava_surge, elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:36.565 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom bloodlust, elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.328 single_asc X flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:38.146 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:39.234 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:40.322 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom bloodlust, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:41.409 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:42.820 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:44.231 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:45.270 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:46.310 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:47.694 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.078 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:50.116 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom lava_surge, elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.176 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.588 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.646 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.059 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.472 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom lava_surge, elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.484 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.831 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.840 single_asc X flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.850 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.197 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.544 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.891 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.236 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:07.556 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:08.594 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:09.978 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:11.300 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_critical_strike, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:12.621 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:13.940 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.950 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:16.297 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.306 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.317 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:19.328 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_critical_strike, elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:20.338 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_critical_strike, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:21.398 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.458 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.458 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:23.517 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:24.579 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:25.638 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:27.049 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:28.395 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.404 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.404 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:30.751 single_asc X flame_shock Fluffy_Pillow_Beast1 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:31.762 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:33.107 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:34.454 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:35.464 aoe H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:36.475 aoe H flame_shock Fluffy_Pillow_Heavy_Spear1 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:37.485 aoe H flame_shock Fluffy_Pillow_Heavy_Spear2 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:38.543 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:39.952 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:41.364 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:42.711 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:44.058 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom elemental_blast_haste, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:45.404 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:46.414 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:47.426 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.774 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.784 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.130 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom lava_surge, elemental_blast_haste, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.140 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 69.0/125: 55% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.198 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/125: 16% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.610 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 51.0/125: 41% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.668 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.080 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 8.0/125: 6% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.117 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.871 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.255 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.641 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.641 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.026 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.440 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.823 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:07.205 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 107.0/125: 86% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:08.588 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:09.627 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:11.008 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.355 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.701 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.713 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.061 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.407 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:18.415 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.426 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_blast_haste, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:20.437 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:21.451 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:22.510 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:22.510 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:23.568 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:24.627 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:25.686 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:27.098 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:28.443 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:29.790 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:30.802 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.148 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.494 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:34.840 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:36.186 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:37.533 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:38.945 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:40.503 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:41.564 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:42.576 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:43.921 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:44.930 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:46.275 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:47.595 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.588 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.579 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.898 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.888 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.926 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:53.965 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.349 single_asc R flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.387 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 6.0/125: 5% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.770 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.117 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 21.0/125: 17% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.465 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.810 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.156 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.502 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.850 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.860 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.870 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.283 single_asc P ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.283 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.695 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.108 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.519 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.576 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom ascendance, lava_surge, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.634 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:16.692 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.750 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:19.162 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom ascendance, elemental_blast_critical_strike, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.223 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 81.0/125: 65% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.284 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom ascendance, elemental_blast_critical_strike, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.694 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom ascendance, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.694 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom ascendance, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.753 aoe L lava_beam Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom ascendance, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.165 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.550 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_blast_mastery, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.588 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.909 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.901 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.221 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.213 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.533 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.526 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.0/125: 10% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:35.848 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.0/125: 18% maelstrom lava_surge, elemental_blast_haste, elemental_blast_mastery, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:36.839 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_blast_haste, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.187 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.598 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.010 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:42.070 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:43.130 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/125: 2% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.542 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/125: 12% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:45.953 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:46.992 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:48.375 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:49.412 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:50.796 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom lava_surge, elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:51.835 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:52.896 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:54.309 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.720 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.131 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.886 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom lava_surge, elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.946 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.359 single_asc T earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.398 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.398 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.784 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 19.0/125: 15% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:03.823 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 7.0/125: 6% maelstrom elemental_blast_mastery, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:05.207 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom elemental_blast_mastery, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:06.592 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_blast_mastery, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:07.977 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:09.362 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.745 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.064 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.409 single_asc d lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.755 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.0/125: 89% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.101 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 124.0/125: 99% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.114 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.126 aoe M chain_lightning Fluffy_Pillow_Pack_Beast1 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom elemental_blast_haste, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.471 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_haste, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.482 aoe F stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_blast_haste, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.493 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.551 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.551 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/125: 8% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.611 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.672 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 12.0/125: 10% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.711 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:27.093 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:28.132 single_asc V lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_blast_critical_strike, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:29.169 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.0/125: 70% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:30.551 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 101.0/125: 81% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:31.962 single_asc Q flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:33.022 single_asc Y earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.082 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:35.494 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 11.0/125: 9% maelstrom elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:36.907 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_blast_critical_strike, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:38.319 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:39.731 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:41.144 single_asc b lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom elemental_blast_critical_strike, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:42.555 single_asc c chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 84.0/125: 67% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:43.968 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.0/125: 87% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:45.027 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:46.086 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:47.124 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:48.508 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:49.547 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:50.586 aoe M chain_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:51.970 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:53.008 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.067 aoe I earthquake Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.125 single_asc S elemental_blast Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.536 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom lava_surge, elemental_blast_critical_strike, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.595 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, elemental_blast_critical_strike, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.655 single_asc W lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom elemental_blast_critical_strike, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 84569 84569 44143
Intellect 59480 57249 47198 (23864)
Spirit 0 0 0
Health 5074140 5074140 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 59480 57249 0
Crit 20.30% 20.30% 6121
Haste 39.30% 39.30% 11779
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 58.75% 58.75% 7242
Armor 3248 3248 3248
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 936.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet Star-Stalker Treads
ilevel: 940, stats: { 377 Armor, +3544 Sta, +2362 AgiInt, +904 Crit, +534 Mastery }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Vicegrip of the Unrepentant
ilevel: 940, stats: { 342 Armor, +3544 Sta, +2362 AgiInt, +904 Haste, +534 Crit }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="tgt_eq"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3112331
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:7:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:5:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=vicegrip_of_the_unrepentant,id=147048,ilevel=940
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=starstalker_treads,id=147046,ilevel=940
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,ilevel=954
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=935.50
# gear_stamina=44143
# gear_intellect=47198
# gear_crit_rating=6121
# gear_haste_rating=11779
# gear_mastery_rating=7242
# gear_versatility_rating=2624
# gear_armor=3248
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Simulation & Raid Information

Iterations: 5818
Threads: 8
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.0 )

Performance:

Total Events Processed: 887571456
Max Event Queue: 75
Sim Seconds: 1745446
CPU Seconds: 369.9375
Physical Seconds: 48.7325
Speed Up: 4718

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
3ilevel 3ilevel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.92sec 0 300.02sec
3ilevel 3ilevel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
3ilevel 3ilevel chain_lightning 188443 58854974 196172 33.21 245095 706582 41.8 166.1 23.7% 0.0% 0.0% 0.0% 6.44sec 58854974 300.02sec
3ilevel 3ilevel chain_lightning_overload 45297 69151681 230492 45.34 211373 608958 51.0 226.7 23.5% 0.0% 0.0% 0.0% 9.52sec 69151681 300.02sec
3ilevel 3ilevel earth_shock 8042 19754539 65845 1.90 1392921 4077991 9.5 9.5 25.5% 0.0% 0.0% 0.0% 31.55sec 19754539 300.02sec
3ilevel 3ilevel earthquake 61882 0 0 0.00 0 0 48.2 0.0 0.0% 0.0% 0.0% 0.0% 5.86sec 0 300.02sec
3ilevel 3ilevel earthquake_ 77478 160227495 534060 292.78 76438 223505 286.0 1464.0 22.4% 0.0% 0.0% 0.0% 0.98sec 160227495 300.02sec
3ilevel 3ilevel seismic_lightning 243073 58609433 195353 14.64 559426 1635375 73.2 73.2 22.4% 0.0% 0.0% 0.0% 4.40sec 58609433 300.02sec
3ilevel 3ilevel elemental_blast 117014 17791380 59301 3.98 603263 1765727 19.9 19.9 24.9% 0.0% 0.0% 0.0% 15.29sec 17791380 300.02sec
3ilevel 3ilevel elemental_blast_overload 120588 9408870 31361 2.51 506903 1481935 12.6 12.6 24.8% 0.0% 0.0% 0.0% 23.52sec 9408870 300.02sec
3ilevel 3ilevel fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.46sec 0 300.02sec
3ilevel 3ilevel flame_shock 188389 5808607 19361 5.26 89213 266807 26.3 26.3 74.1% 0.0% 0.0% 0.0% 11.28sec 53475856 300.02sec
3ilevel 3ilevel flame_shock ticks -188389 47667249 158891 60.37 48713 198119 26.3 301.8 73.1% 0.0% 0.0% 0.0% 11.28sec 53475856 300.02sec
3ilevel 3ilevel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
3ilevel 3ilevel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
3ilevel 3ilevel insidious_corruption ticks -243941 4365022 14550 9.60 73511 149451 5.1 48.0 23.0% 0.0% 0.0% 0.0% 60.37sec 4365022 300.02sec
3ilevel 3ilevel lava_beam 114074 18247539 60822 7.20 356066 1040174 7.5 36.0 22.0% 0.0% 0.0% 0.0% 28.82sec 18247539 300.02sec
3ilevel 3ilevel lava_beam_overload 114738 22856404 76184 10.91 294256 858638 11.1 54.6 22.1% 0.0% 0.0% 0.0% 40.92sec 22856404 300.02sec
3ilevel 3ilevel lava_burst 51505 48762877 162533 11.12 256588 877250 55.6 55.6 100.0% 0.0% 0.0% 0.0% 5.31sec 48762877 300.02sec
3ilevel 3ilevel lava_burst_overload 77451 24904657 83011 7.07 216998 704531 35.4 35.4 100.0% 0.0% 0.0% 0.0% 8.31sec 24904657 300.02sec
3ilevel 3ilevel volcanic_inferno 205533 5728751 19095 19.23 47550 96927 41.6 96.1 24.4% 0.0% 0.0% 0.0% 6.68sec 5728751 300.02sec
3ilevel 3ilevel lightning_bolt 188196 13143685 43810 7.68 230606 658889 38.4 38.4 26.0% 0.0% 0.0% 0.0% 7.60sec 13143685 300.02sec
3ilevel 3ilevel lightning_bolt_overload 45284 12379621 41263 8.61 194510 556481 43.1 43.1 25.7% 0.0% 0.0% 0.0% 9.07sec 12379621 300.02sec
3ilevel 3ilevel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
3ilevel 3ilevel spectral_owl 242570 13579156 45261 18.87 116064 236771 3.0 94.4 23.1% 0.0% 0.0% 0.0% 120.36sec 13579156 300.02sec
3ilevel 3ilevel spectral_blast 246442 6346246 21153 7.54 135409 276235 37.7 37.7 23.3% 0.0% 0.0% 0.0% 6.95sec 6346246 300.02sec
3ilevel 3ilevel stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.14sec 0 300.02sec
3ilevel 3ilevel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.64sec 0 300.02sec
3ilevel 3ilevel_primal_fire_elemental fire_blast 57984 25976613 135436 30.27 215539 431111 96.8 96.8 24.5% 0.0% 0.0% 0.0% 2.98sec 25976613 191.80sec
3ilevel 3ilevel_greater_lightning_elemental lightning_blast 191726 7325402 179827 55.47 158437 317182 37.7 37.7 22.7% 0.0% 0.0% 0.0% 7.48sec 7325402 40.74sec
baseline baseline ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.96sec 0 299.98sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
baseline baseline chain_lightning 188443 56341541 187820 33.24 240800 656899 41.8 166.2 23.6% 0.0% 0.0% 0.0% 6.40sec 56341541 299.98sec
baseline baseline chain_lightning_overload 45297 66415363 221402 45.55 207859 565131 51.1 227.7 23.5% 0.0% 0.0% 0.0% 9.50sec 66415363 299.98sec
baseline baseline earth_shock 8042 18882670 62947 1.90 1369630 3796123 9.5 9.5 25.4% 0.0% 0.0% 0.0% 31.50sec 18882670 299.98sec
baseline baseline earthquake 61882 0 0 0.00 0 0 48.2 0.0 0.0% 0.0% 0.0% 0.0% 5.82sec 0 299.98sec
baseline baseline earthquake_ 77478 153593981 512021 293.03 75099 207890 286.2 1465.0 22.4% 0.0% 0.0% 0.0% 0.97sec 153593981 299.98sec
baseline baseline seismic_lightning 243073 56328451 187777 14.68 549606 1521204 73.4 73.4 22.4% 0.0% 0.0% 0.0% 4.36sec 56328451 299.98sec
baseline baseline elemental_blast 117014 17008364 56699 3.99 592920 1643309 19.9 19.9 24.8% 0.0% 0.0% 0.0% 15.28sec 17008364 299.98sec
baseline baseline elemental_blast_overload 120588 8997624 29994 2.52 498100 1380232 12.6 12.6 24.6% 0.0% 0.0% 0.0% 23.25sec 8997624 299.98sec
baseline baseline fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.63sec 0 299.98sec
baseline baseline flame_shock 188389 5432483 18110 5.26 87616 248271 26.3 26.3 74.0% 0.0% 0.0% 0.0% 11.46sec 50044874 299.98sec
baseline baseline flame_shock ticks -188389 44612391 148708 60.48 47831 184255 26.3 302.4 73.1% 0.0% 0.0% 0.0% 11.46sec 50044874 299.98sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
baseline baseline insidious_corruption ticks -243941 4354969 14517 9.60 73498 149606 5.1 48.0 22.7% 0.0% 0.0% 0.0% 60.35sec 4354969 299.98sec
baseline baseline lava_beam 114074 17499413 58336 7.19 350774 965792 7.5 35.9 22.1% 0.0% 0.0% 0.0% 28.85sec 17499413 299.98sec
baseline baseline lava_beam_overload 114738 21787519 72631 10.85 288315 802265 11.0 54.3 22.0% 0.0% 0.0% 0.0% 41.01sec 21787519 299.98sec
baseline baseline lava_burst 51505 45238468 150807 11.12 255842 813517 55.6 55.6 100.0% 0.0% 0.0% 0.0% 5.36sec 45238468 299.98sec
baseline baseline lava_burst_overload 77451 23282854 77616 7.09 214643 657061 35.4 35.4 100.0% 0.0% 0.0% 0.0% 8.35sec 23282854 299.98sec
baseline baseline volcanic_inferno 205533 5570089 18568 19.02 46727 95255 41.4 95.1 24.4% 0.0% 0.0% 0.0% 6.70sec 5570089 299.98sec
baseline baseline lightning_bolt 188196 12531843 41776 7.67 226394 612224 38.4 38.4 26.0% 0.0% 0.0% 0.0% 7.53sec 12531843 299.98sec
baseline baseline lightning_bolt_overload 45284 11943933 39816 8.67 191028 516749 43.4 43.4 25.9% 0.0% 0.0% 0.0% 8.96sec 11943933 299.98sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.98sec
baseline baseline spectral_owl 242570 13584110 45284 18.88 116064 236771 3.0 94.4 23.1% 0.0% 0.0% 0.0% 120.33sec 13584110 299.98sec
baseline baseline spectral_blast 246442 6348136 21162 7.57 135409 276235 37.8 37.8 23.0% 0.0% 0.0% 0.0% 6.91sec 6348136 299.98sec
baseline baseline stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.19sec 0 299.98sec
baseline baseline totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.64sec 0 299.98sec
baseline baseline_primal_fire_elemental fire_blast 57984 25540608 133036 30.28 211819 423650 96.9 96.9 24.4% 0.0% 0.0% 0.0% 2.98sec 25540608 191.98sec
baseline baseline_greater_lightning_elemental lightning_blast 191726 7177985 176135 55.47 155648 311473 37.7 37.7 22.4% 0.0% 0.0% 0.0% 7.48sec 7177985 40.75sec
ctt_nature ctt_nature ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.99sec 0 300.02sec
ctt_nature ctt_nature augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ctt_nature ctt_nature chain_lightning 188443 58610694 195358 33.36 249949 678693 42.0 166.8 23.7% 0.0% 0.0% 0.0% 6.39sec 58610694 300.02sec
ctt_nature ctt_nature chain_lightning_overload 45297 69240360 230788 45.66 215705 588278 51.3 228.3 23.5% 0.0% 0.0% 0.0% 9.49sec 69240360 300.02sec
ctt_nature ctt_nature earth_shock 8042 19531151 65100 1.90 1417003 3922282 9.5 9.5 25.5% 0.0% 0.0% 0.0% 31.72sec 19531151 300.02sec
ctt_nature ctt_nature earthquake 61882 0 0 0.00 0 0 48.3 0.0 0.0% 0.0% 0.0% 0.0% 5.81sec 0 300.02sec
ctt_nature ctt_nature earthquake_ 77478 155003285 516647 293.59 75615 209309 286.8 1468.1 22.4% 0.0% 0.0% 0.0% 0.97sec 155003285 300.02sec
ctt_nature ctt_nature seismic_lightning 243073 58488304 194950 14.71 569268 1575312 73.5 73.5 22.5% 0.0% 0.0% 0.0% 4.34sec 58488304 300.02sec
ctt_nature ctt_nature elemental_blast 117014 17640729 58799 3.99 613950 1701644 19.9 19.9 24.9% 0.0% 0.0% 0.0% 15.28sec 17640729 300.02sec
ctt_nature ctt_nature elemental_blast_overload 120588 9299065 30995 2.52 515712 1429185 12.6 12.6 24.2% 0.0% 0.0% 0.0% 23.03sec 9299065 300.02sec
ctt_nature ctt_nature fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 107.15sec 0 300.02sec
ctt_nature ctt_nature flame_shock 188389 5449314 18163 5.24 88206 249904 26.2 26.2 74.1% 0.0% 0.0% 0.0% 11.41sec 50282415 300.02sec
ctt_nature ctt_nature flame_shock ticks -188389 44833100 149444 60.32 48138 185596 26.2 301.6 73.1% 0.0% 0.0% 0.0% 11.41sec 50282415 300.02sec
ctt_nature ctt_nature flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ctt_nature ctt_nature food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ctt_nature ctt_nature insidious_corruption ticks -243941 4354799 14516 9.60 73520 149524 5.1 48.0 22.6% 0.0% 0.0% 0.0% 60.36sec 4354799 300.02sec
ctt_nature ctt_nature lava_beam 114074 17676856 58919 7.20 353129 974665 7.5 36.0 22.1% 0.0% 0.0% 0.0% 28.62sec 17676856 300.02sec
ctt_nature ctt_nature lava_beam_overload 114738 21953439 73174 10.77 292440 812441 11.0 53.8 22.2% 0.0% 0.0% 0.0% 41.05sec 21953439 300.02sec
ctt_nature ctt_nature lava_burst 51505 45466576 151546 11.10 255675 819142 55.5 55.5 100.0% 0.0% 0.0% 0.0% 5.32sec 45466576 300.02sec
ctt_nature ctt_nature lava_burst_overload 77451 23307160 77686 7.05 214615 661509 35.2 35.2 100.0% 0.0% 0.0% 0.0% 8.31sec 23307160 300.02sec
ctt_nature ctt_nature volcanic_inferno 205533 5570053 18566 18.91 47021 95865 41.2 94.6 24.3% 0.0% 0.0% 0.0% 6.54sec 5570053 300.02sec
ctt_nature ctt_nature lightning_bolt 188196 12958104 43191 7.65 234009 636450 38.3 38.3 26.0% 0.0% 0.0% 0.0% 7.64sec 12958104 300.02sec
ctt_nature ctt_nature lightning_bolt_overload 45284 12276764 40920 8.63 197269 535366 43.2 43.2 25.8% 0.0% 0.0% 0.0% 9.08sec 12276764 300.02sec
ctt_nature ctt_nature potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.02sec
ctt_nature ctt_nature spectral_owl 242570 13607217 45355 18.91 116064 236771 3.0 94.6 23.0% 0.0% 0.0% 0.0% 120.35sec 13607217 300.02sec
ctt_nature ctt_nature spectral_blast 246442 6366609 21221 7.58 135409 276235 37.9 37.9 23.1% 0.0% 0.0% 0.0% 6.97sec 6366609 300.02sec
ctt_nature ctt_nature stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.19sec 0 300.02sec
ctt_nature ctt_nature totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.64sec 0 300.02sec
ctt_nature ctt_nature_primal_fire_elemental fire_blast 57984 25647594 133787 30.28 213215 426314 96.8 96.8 24.3% 0.0% 0.0% 0.0% 2.99sec 25647594 191.70sec
ctt_nature ctt_nature_greater_lightning_elemental lightning_blast 191726 7247036 177461 55.46 156727 313593 37.8 37.8 22.5% 0.0% 0.0% 0.0% 7.50sec 7247036 40.84sec
ea_es ea_es ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.02sec 0 300.01sec
ea_es ea_es augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ea_es ea_es chain_lightning 188443 56862409 189537 33.37 241982 660244 42.1 166.9 23.6% 0.0% 0.0% 0.0% 6.40sec 56862409 300.01sec
ea_es ea_es chain_lightning_overload 45297 66887640 222953 45.65 208713 568977 51.3 228.3 23.4% 0.0% 0.0% 0.0% 9.55sec 66887640 300.01sec
ea_es ea_es earth_shock 8042 21021393 70070 1.91 1520658 4206096 9.5 9.5 25.4% 0.0% 0.0% 0.0% 31.14sec 21021393 300.01sec
ea_es ea_es earthquake 61882 0 0 0.00 0 0 48.3 0.0 0.0% 0.0% 0.0% 0.0% 5.86sec 0 300.01sec
ea_es ea_es earthquake_ 77478 154789946 515954 293.13 75611 209304 286.3 1465.7 22.4% 0.0% 0.0% 0.0% 0.98sec 154789946 300.01sec
ea_es ea_es seismic_lightning 243073 56531036 188432 14.64 553275 1531175 73.2 73.2 22.4% 0.0% 0.0% 0.0% 4.37sec 56531036 300.01sec
ea_es ea_es elemental_blast 117014 17181010 57269 3.99 596577 1653772 19.9 19.9 25.1% 0.0% 0.0% 0.0% 15.29sec 17181010 300.01sec
ea_es ea_es elemental_blast_overload 120588 9099815 30332 2.52 501323 1389354 12.6 12.6 24.9% 0.0% 0.0% 0.0% 23.14sec 9099815 300.01sec
ea_es ea_es fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.41sec 0 300.01sec
ea_es ea_es flame_shock 188389 5453863 18179 5.24 88221 249899 26.2 26.2 74.2% 0.0% 0.0% 0.0% 11.40sec 50306499 300.01sec
ea_es ea_es flame_shock ticks -188389 44852636 149509 60.33 48148 185528 26.2 301.6 73.2% 0.0% 0.0% 0.0% 11.40sec 50306499 300.01sec
ea_es ea_es flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ea_es ea_es food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ea_es ea_es insidious_corruption ticks -243941 4358971 14530 9.60 73496 149565 5.1 48.0 22.8% 0.0% 0.0% 0.0% 60.37sec 4358971 300.01sec
ea_es ea_es lava_beam 114074 17633554 58777 7.18 353798 978965 7.5 35.9 22.0% 0.0% 0.0% 0.0% 29.03sec 17633554 300.01sec
ea_es ea_es lava_beam_overload 114738 22270097 74232 10.90 293468 811797 11.1 54.5 22.2% 0.0% 0.0% 0.0% 40.84sec 22270097 300.01sec
ea_es ea_es lava_burst 51505 45473426 151574 11.10 253316 819070 55.5 55.5 100.0% 0.0% 0.0% 0.0% 5.30sec 45473426 300.01sec
ea_es ea_es lava_burst_overload 77451 23335850 77784 7.06 221170 661400 35.3 35.3 100.0% 0.0% 0.0% 0.0% 8.23sec 23335850 300.01sec
ea_es ea_es volcanic_inferno 205533 5590577 18635 18.97 47030 95862 41.3 94.8 24.4% 0.0% 0.0% 0.0% 6.57sec 5590577 300.01sec
ea_es ea_es lightning_bolt 188196 12605229 42016 7.64 227762 619156 38.2 38.2 26.1% 0.0% 0.0% 0.0% 7.61sec 12605229 300.01sec
ea_es ea_es lightning_bolt_overload 45284 11943895 39812 8.63 192236 521233 43.1 43.1 25.7% 0.0% 0.0% 0.0% 9.02sec 11943895 300.01sec
ea_es ea_es potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
ea_es ea_es spectral_owl 242570 13571123 45236 18.86 116064 236771 3.0 94.3 23.0% 0.0% 0.0% 0.0% 120.33sec 13571123 300.01sec
ea_es ea_es spectral_blast 246442 6347207 21157 7.56 135409 276235 37.8 37.8 23.0% 0.0% 0.0% 0.0% 6.92sec 6347207 300.01sec
ea_es ea_es stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.25sec 0 300.01sec
ea_es ea_es totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.64sec 0 300.01sec
ea_es ea_es_primal_fire_elemental fire_blast 57984 25708532 133896 30.27 213225 426440 96.9 96.9 24.5% 0.0% 0.0% 0.0% 2.98sec 25708532 192.00sec
ea_es ea_es_greater_lightning_elemental lightning_blast 191726 7232950 177492 55.47 156699 313496 37.7 37.7 22.5% 0.0% 0.0% 0.0% 7.50sec 7232950 40.75sec
ede_crit ede_crit ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.95sec 0 300.00sec
ede_crit ede_crit augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ede_crit ede_crit chain_lightning 188443 58247426 194160 33.29 242395 698661 41.9 166.4 23.6% 0.0% 0.0% 0.0% 6.41sec 58247426 300.00sec
ede_crit ede_crit chain_lightning_overload 45297 68780745 229272 45.67 209048 601815 51.3 228.3 23.5% 0.0% 0.0% 0.0% 9.44sec 68780745 300.00sec
ede_crit ede_crit earth_shock 8042 19602563 65343 1.91 1377371 4034126 9.5 9.5 25.5% 0.0% 0.0% 0.0% 31.69sec 19602563 300.00sec
ede_crit ede_crit earthquake 61882 0 0 0.00 0 0 48.2 0.0 0.0% 0.0% 0.0% 0.0% 5.82sec 0 300.00sec
ede_crit ede_crit earthquake_ 77478 158383834 527952 292.93 75592 221011 286.2 1464.6 22.4% 0.0% 0.0% 0.0% 0.97sec 158383834 300.00sec
ede_crit ede_crit seismic_lightning 243073 57821086 192739 14.60 553207 1617427 73.0 73.0 22.4% 0.0% 0.0% 0.0% 4.35sec 57821086 300.00sec
ede_crit ede_crit elemental_blast 117014 17558302 58528 3.99 596760 1746136 19.9 19.9 24.7% 0.0% 0.0% 0.0% 15.28sec 17558302 300.00sec
ede_crit ede_crit elemental_blast_overload 120588 9323426 31078 2.52 501343 1467700 12.6 12.6 24.8% 0.0% 0.0% 0.0% 23.41sec 9323426 300.00sec
ede_crit ede_crit fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.47sec 0 300.00sec
ede_crit ede_crit flame_shock 188389 5731006 19104 5.24 88207 264002 26.2 26.2 74.2% 0.0% 0.0% 0.0% 11.29sec 52903049 300.00sec
ede_crit ede_crit flame_shock ticks -188389 47172042 157240 60.32 48163 195954 26.2 301.6 73.2% 0.0% 0.0% 0.0% 11.29sec 52903049 300.00sec
ede_crit ede_crit flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ede_crit ede_crit food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ede_crit ede_crit insidious_corruption ticks -243941 4365367 14551 9.60 73502 149646 5.1 48.0 22.9% 0.0% 0.0% 0.0% 60.36sec 4365367 300.00sec
ede_crit ede_crit lava_beam 114074 18066593 60223 7.19 352624 1031775 7.5 35.9 22.1% 0.0% 0.0% 0.0% 28.83sec 18066593 300.00sec
ede_crit ede_crit lava_beam_overload 114738 22574915 75251 10.87 291265 851744 11.1 54.3 22.2% 0.0% 0.0% 0.0% 40.75sec 22574915 300.00sec
ede_crit ede_crit lava_burst 51505 48171455 160573 11.10 263226 867743 55.5 55.5 100.0% 0.0% 0.0% 0.0% 5.30sec 48171455 300.00sec
ede_crit ede_crit lava_burst_overload 77451 24556097 81855 7.05 214695 696742 35.2 35.2 100.0% 0.0% 0.0% 0.0% 8.30sec 24556097 300.00sec
ede_crit ede_crit volcanic_inferno 205533 5555503 18519 18.85 47043 95908 41.2 94.2 24.4% 0.0% 0.0% 0.0% 6.60sec 5555503 300.00sec
ede_crit ede_crit lightning_bolt 188196 12979058 43264 7.69 227827 650578 38.4 38.4 26.0% 0.0% 0.0% 0.0% 7.67sec 12979058 300.00sec
ede_crit ede_crit lightning_bolt_overload 45284 12298742 40996 8.65 191919 551696 43.2 43.2 25.7% 0.0% 0.0% 0.0% 9.09sec 12298742 300.00sec
ede_crit ede_crit potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
ede_crit ede_crit spectral_owl 242570 13599052 45331 18.89 116064 236771 3.0 94.4 23.1% 0.0% 0.0% 0.0% 120.33sec 13599052 300.00sec
ede_crit ede_crit spectral_blast 246442 6360918 21203 7.58 135409 276235 37.9 37.9 23.1% 0.0% 0.0% 0.0% 6.93sec 6360918 300.00sec
ede_crit ede_crit stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.19sec 0 300.00sec
ede_crit ede_crit totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.66sec 0 300.00sec
ede_crit ede_crit_primal_fire_elemental fire_blast 57984 25702354 133878 30.28 213226 426434 96.9 96.9 24.4% 0.0% 0.0% 0.0% 2.98sec 25702354 191.98sec
ede_crit ede_crit_greater_lightning_elemental lightning_blast 191726 7240676 177655 55.48 156703 313742 37.7 37.7 22.6% 0.0% 0.0% 0.0% 7.49sec 7240676 40.76sec
edi_cl edi_cl ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.91sec 0 300.01sec
edi_cl edi_cl augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl chain_lightning 188443 64061716 213529 33.38 272736 742842 42.1 166.9 23.6% 0.0% 0.0% 0.0% 6.36sec 64061716 300.01sec
edi_cl edi_cl chain_lightning_overload 45297 75320499 251056 45.61 234871 641091 51.3 228.0 23.5% 0.0% 0.0% 0.0% 9.49sec 75320499 300.01sec
edi_cl edi_cl earth_shock 8042 19006653 63352 1.90 1378562 3817290 9.5 9.5 25.5% 0.0% 0.0% 0.0% 31.75sec 19006653 300.01sec
edi_cl edi_cl earthquake 61882 0 0 0.00 0 0 48.3 0.0 0.0% 0.0% 0.0% 0.0% 5.83sec 0 300.01sec
edi_cl edi_cl earthquake_ 77478 154706092 515662 293.03 75604 209276 286.5 1465.2 22.4% 0.0% 0.0% 0.0% 0.97sec 154706092 300.01sec
edi_cl edi_cl seismic_lightning 243073 56592958 188634 14.65 553341 1531128 73.3 73.3 22.4% 0.0% 0.0% 0.0% 4.34sec 56592958 300.01sec
edi_cl edi_cl elemental_blast 117014 17136902 57120 3.99 596655 1653059 19.9 19.9 24.9% 0.0% 0.0% 0.0% 15.28sec 17136902 300.01sec
edi_cl edi_cl elemental_blast_overload 120588 9002455 30007 2.51 501244 1388548 12.5 12.5 24.4% 0.0% 0.0% 0.0% 23.62sec 9002455 300.01sec
edi_cl edi_cl fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.72sec 0 300.01sec
edi_cl edi_cl flame_shock 188389 5447149 18156 5.24 88225 249792 26.2 26.2 74.2% 0.0% 0.0% 0.0% 11.35sec 50215733 300.01sec
edi_cl edi_cl flame_shock ticks -188389 44768584 149229 60.30 48178 185484 26.2 301.5 73.1% 0.0% 0.0% 0.0% 11.35sec 50215733 300.01sec
edi_cl edi_cl flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl insidious_corruption ticks -243941 4363842 14546 9.60 73471 149732 5.1 48.0 22.9% 0.0% 0.0% 0.0% 60.35sec 4363842 300.01sec
edi_cl edi_cl lava_beam 114074 19913957 66377 7.21 398343 1094350 7.5 36.1 22.1% 0.0% 0.0% 0.0% 28.70sec 19913957 300.01sec
edi_cl edi_cl lava_beam_overload 114738 24550329 81830 10.76 327316 908859 11.0 53.8 22.2% 0.0% 0.0% 0.0% 40.79sec 24550329 300.01sec
edi_cl edi_cl lava_burst 51505 45431547 151431 11.09 255778 819072 55.5 55.5 100.0% 0.0% 0.0% 0.0% 5.34sec 45431547 300.01sec
edi_cl edi_cl lava_burst_overload 77451 23269273 77560 7.04 210554 661460 35.2 35.2 100.0% 0.0% 0.0% 0.0% 8.43sec 23269273 300.01sec
edi_cl edi_cl volcanic_inferno 205533 5616139 18720 19.04 47050 95913 41.2 95.2 24.4% 0.0% 0.0% 0.0% 6.63sec 5616139 300.01sec
edi_cl edi_cl lightning_bolt 188196 12554919 41848 7.66 227365 616502 38.3 38.3 25.9% 0.0% 0.0% 0.0% 7.62sec 12554919 300.01sec
edi_cl edi_cl lightning_bolt_overload 45284 11964488 39880 8.64 191861 520191 43.2 43.2 25.9% 0.0% 0.0% 0.0% 9.09sec 11964488 300.01sec
edi_cl edi_cl potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
edi_cl edi_cl spectral_owl 242570 13610158 45365 18.90 116064 236771 3.0 94.5 23.1% 0.0% 0.0% 0.0% 120.33sec 13610158 300.01sec
edi_cl edi_cl spectral_blast 246442 6341694 21138 7.56 135409 276235 37.8 37.8 23.0% 0.0% 0.0% 0.0% 6.90sec 6341694 300.01sec
edi_cl edi_cl stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.13sec 0 300.01sec
edi_cl edi_cl totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.64sec 0 300.01sec
edi_cl edi_cl_primal_fire_elemental fire_blast 57984 25672954 133908 30.27 213204 426405 96.7 96.7 24.5% 0.0% 0.0% 0.0% 2.98sec 25672954 191.72sec
edi_cl edi_cl_greater_lightning_elemental lightning_blast 191726 7230344 177586 55.49 156702 313699 37.7 37.7 22.5% 0.0% 0.0% 0.0% 7.49sec 7230344 40.71sec
fs_fs fs_fs ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.93sec 0 300.04sec
fs_fs fs_fs augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
fs_fs fs_fs chain_lightning 188443 56986501 189932 33.40 242310 661310 42.0 167.0 23.6% 0.0% 0.0% 0.0% 6.36sec 56986501 300.04sec
fs_fs fs_fs chain_lightning_overload 45297 67031343 223410 45.64 208960 569021 51.3 228.2 23.5% 0.0% 0.0% 0.0% 9.49sec 67031343 300.04sec
fs_fs fs_fs earth_shock 8042 19015435 63377 1.90 1377976 3819440 9.5 9.5 25.6% 0.0% 0.0% 0.0% 31.73sec 19015435 300.04sec
fs_fs fs_fs earthquake 61882 0 0 0.00 0 0 48.3 0.0 0.0% 0.0% 0.0% 0.0% 5.82sec 0 300.04sec
fs_fs fs_fs earthquake_ 77478 154746282 515757 293.15 75585 209219 286.6 1465.9 22.4% 0.0% 0.0% 0.0% 0.97sec 154746282 300.04sec
fs_fs fs_fs seismic_lightning 243073 56814721 189359 14.70 553138 1531276 73.5 73.5 22.4% 0.0% 0.0% 0.0% 4.37sec 56814721 300.04sec
fs_fs fs_fs elemental_blast 117014 17104766 57009 3.98 596629 1653587 19.9 19.9 24.8% 0.0% 0.0% 0.0% 15.30sec 17104766 300.04sec
fs_fs fs_fs elemental_blast_overload 120588 9088256 30290 2.52 501026 1389213 12.6 12.6 24.9% 0.0% 0.0% 0.0% 23.48sec 9088256 300.04sec
fs_fs fs_fs fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.76sec 0 300.04sec
fs_fs fs_fs flame_shock 188389 6457334 21522 5.25 104254 295198 26.3 26.3 74.2% 0.0% 0.0% 0.0% 11.37sec 59406056 300.04sec
fs_fs fs_fs flame_shock ticks -188389 52948722 176496 60.35 56908 219215 26.3 301.8 73.0% 0.0% 0.0% 0.0% 11.37sec 59406056 300.04sec
fs_fs fs_fs flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
fs_fs fs_fs food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
fs_fs fs_fs insidious_corruption ticks -243941 4361110 14537 9.60 73521 149432 5.1 48.0 22.8% 0.0% 0.0% 0.0% 60.35sec 4361110 300.04sec
fs_fs fs_fs lava_beam 114074 17687111 58950 7.22 353044 973083 7.5 36.1 22.1% 0.0% 0.0% 0.0% 28.54sec 17687111 300.04sec
fs_fs fs_fs lava_beam_overload 114738 21850661 72827 10.74 291690 810767 10.9 53.7 22.2% 0.0% 0.0% 0.0% 40.27sec 21850661 300.04sec
fs_fs fs_fs lava_burst 51505 45451366 151486 11.10 251733 819101 55.5 55.5 100.0% 0.0% 0.0% 0.0% 5.33sec 45451366 300.04sec
fs_fs fs_fs lava_burst_overload 77451 23272446 77565 7.03 210882 661674 35.2 35.2 100.0% 0.0% 0.0% 0.0% 8.37sec 23272446 300.04sec
fs_fs fs_fs volcanic_inferno 205533 5587950 18624 18.93 47040 95899 41.2 94.7 24.5% 0.0% 0.0% 0.0% 6.62sec 5587950 300.04sec
fs_fs fs_fs lightning_bolt 188196 12602256 42002 7.66 227911 616171 38.3 38.3 26.1% 0.0% 0.0% 0.0% 7.64sec 12602256 300.04sec
fs_fs fs_fs lightning_bolt_overload 45284 11955786 39848 8.63 192315 521130 43.2 43.2 25.7% 0.0% 0.0% 0.0% 9.10sec 11955786 300.04sec
fs_fs fs_fs potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.04sec
fs_fs fs_fs spectral_owl 242570 13576793 45250 18.87 116064 236771 3.0 94.4 23.1% 0.0% 0.0% 0.0% 120.35sec 13576793 300.04sec
fs_fs fs_fs spectral_blast 246442 6345981 21151 7.57 135409 276235 37.8 37.8 23.0% 0.0% 0.0% 0.0% 6.90sec 6345981 300.04sec
fs_fs fs_fs stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.24sec 0 300.04sec
fs_fs fs_fs totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.65sec 0 300.04sec
fs_fs fs_fs_primal_fire_elemental fire_blast 57984 25675404 133922 30.28 213189 426349 96.8 96.8 24.5% 0.0% 0.0% 0.0% 2.98sec 25675404 191.72sec
fs_fs fs_fs_greater_lightning_elemental lightning_blast 191726 7240752 177614 55.48 156715 313551 37.7 37.7 22.5% 0.0% 0.0% 0.0% 7.49sec 7240752 40.77sec
li_lvb li_lvb ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.93sec 0 300.01sec
li_lvb li_lvb augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
li_lvb li_lvb chain_lightning 188443 56722854 189071 33.33 242243 658709 42.0 166.7 23.6% 0.0% 0.0% 0.0% 6.43sec 56722854 300.01sec
li_lvb li_lvb chain_lightning_overload 45297 66773340 222572 45.56 208472 568902 51.3 227.8 23.5% 0.0% 0.0% 0.0% 9.51sec 66773340 300.01sec
li_lvb li_lvb earth_shock 8042 18996252 63319 1.91 1377795 3815524 9.5 9.5 25.1% 0.0% 0.0% 0.0% 31.75sec 18996252 300.01sec
li_lvb li_lvb earthquake 61882 0 0 0.00 0 0 48.2 0.0 0.0% 0.0% 0.0% 0.0% 5.82sec 0 300.01sec
li_lvb li_lvb earthquake_ 77478 154580997 515257 292.79 75602 209283 286.1 1464.0 22.4% 0.0% 0.0% 0.0% 0.97sec 154580997 300.01sec
li_lvb li_lvb seismic_lightning 243073 56495275 188313 14.62 553322 1530888 73.1 73.1 22.4% 0.0% 0.0% 0.0% 4.35sec 56495275 300.01sec
li_lvb li_lvb elemental_blast 117014 17118771 57061 3.98 596502 1653628 19.9 19.9 24.9% 0.0% 0.0% 0.0% 15.31sec 17118771 300.01sec
li_lvb li_lvb elemental_blast_overload 120588 9107692 30358 2.52 501207 1388998 12.6 12.6 25.0% 0.0% 0.0% 0.0% 23.28sec 9107692 300.01sec
li_lvb li_lvb fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.68sec 0 300.01sec
li_lvb li_lvb flame_shock 188389 5423775 18079 5.22 88214 249778 26.1 26.1 74.1% 0.0% 0.0% 0.0% 11.44sec 50177540 300.01sec
li_lvb li_lvb flame_shock ticks -188389 44753765 149179 60.24 48156 185506 26.1 301.2 73.1% 0.0% 0.0% 0.0% 11.44sec 50177540 300.01sec
li_lvb li_lvb flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
li_lvb li_lvb food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
li_lvb li_lvb insidious_corruption ticks -243941 4363361 14545 9.60 73500 149575 5.1 48.0 22.9% 0.0% 0.0% 0.0% 60.36sec 4363361 300.01sec
li_lvb li_lvb lava_beam 114074 17602650 58674 7.20 352238 969700 7.5 36.0 22.2% 0.0% 0.0% 0.0% 28.79sec 17602650 300.01sec
li_lvb li_lvb lava_beam_overload 114738 21882983 72941 10.78 292536 805301 11.0 53.9 22.1% 0.0% 0.0% 0.0% 40.69sec 21882983 300.01sec
li_lvb li_lvb lava_burst 51505 49057227 163520 11.09 276945 884796 55.4 55.4 100.0% 0.0% 0.0% 0.0% 5.30sec 49057227 300.01sec
li_lvb li_lvb lava_burst_overload 77451 25191009 83968 7.05 224689 714573 35.3 35.3 100.0% 0.0% 0.0% 0.0% 8.28sec 25191009 300.01sec
li_lvb li_lvb volcanic_inferno 205533 5634335 18781 19.11 47022 95849 41.5 95.5 24.5% 0.0% 0.0% 0.0% 6.53sec 5634335 300.01sec
li_lvb li_lvb lightning_bolt 188196 12670181 42233 7.70 228050 616967 38.5 38.5 26.0% 0.0% 0.0% 0.0% 7.60sec 12670181 300.01sec
li_lvb li_lvb lightning_bolt_overload 45284 12019730 40065 8.66 192582 520829 43.3 43.3 25.9% 0.0% 0.0% 0.0% 9.05sec 12019730 300.01sec
li_lvb li_lvb potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
li_lvb li_lvb spectral_owl 242570 13575674 45251 18.87 116064 236771 3.0 94.4 23.0% 0.0% 0.0% 0.0% 120.34sec 13575674 300.01sec
li_lvb li_lvb spectral_blast 246442 6358880 21196 7.56 135409 276235 37.8 37.8 23.3% 0.0% 0.0% 0.0% 7.00sec 6358880 300.01sec
li_lvb li_lvb stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.19sec 0 300.01sec
li_lvb li_lvb totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.67sec 0 300.01sec
li_lvb li_lvb_primal_fire_elemental fire_blast 57984 25686729 133921 30.28 213167 426295 96.8 96.8 24.5% 0.0% 0.0% 0.0% 2.99sec 25686729 191.81sec
li_lvb li_lvb_greater_lightning_elemental lightning_blast 191726 7235237 177687 55.48 156749 313862 37.7 37.7 22.5% 0.0% 0.0% 0.0% 7.49sec 7235237 40.72sec
mb_lvs mb_lvs ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.91sec 0 300.00sec
mb_lvs mb_lvs augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs chain_lightning 188443 56783080 189279 33.32 242316 660244 42.0 166.6 23.6% 0.0% 0.0% 0.0% 6.36sec 56783080 300.00sec
mb_lvs mb_lvs chain_lightning_overload 45297 67005387 223354 45.56 209127 570304 51.2 227.8 23.5% 0.0% 0.0% 0.0% 9.41sec 67005387 300.00sec
mb_lvs mb_lvs earth_shock 8042 19039839 63467 1.90 1380069 3818696 9.5 9.5 25.6% 0.0% 0.0% 0.0% 31.54sec 19039839 300.00sec
mb_lvs mb_lvs earthquake 61882 0 0 0.00 0 0 48.2 0.0 0.0% 0.0% 0.0% 0.0% 5.82sec 0 300.00sec
mb_lvs mb_lvs earthquake_ 77478 154647040 515496 292.98 75593 209251 286.2 1464.9 22.4% 0.0% 0.0% 0.0% 0.97sec 154647040 300.00sec
mb_lvs mb_lvs seismic_lightning 243073 56586314 188623 14.65 553366 1531242 73.2 73.2 22.4% 0.0% 0.0% 0.0% 4.36sec 56586314 300.00sec
mb_lvs mb_lvs elemental_blast 117014 17174872 57250 3.99 596886 1653202 19.9 19.9 25.0% 0.0% 0.0% 0.0% 15.29sec 17174872 300.00sec
mb_lvs mb_lvs elemental_blast_overload 120588 9082093 30274 2.52 501414 1389318 12.6 12.6 24.9% 0.0% 0.0% 0.0% 23.16sec 9082093 300.00sec
mb_lvs mb_lvs fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.78sec 0 300.00sec
mb_lvs mb_lvs flame_shock 188389 5456588 18189 5.25 88256 249828 26.2 26.2 74.1% 0.0% 0.0% 0.0% 11.40sec 50269424 300.00sec
mb_lvs mb_lvs flame_shock ticks -188389 44812836 149376 60.35 48163 185508 26.2 301.7 73.1% 0.0% 0.0% 0.0% 11.40sec 50269424 300.00sec
mb_lvs mb_lvs flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs insidious_corruption ticks -243941 4363990 14547 9.60 73504 149546 5.1 48.0 22.9% 0.0% 0.0% 0.0% 60.37sec 4363990 300.00sec
mb_lvs mb_lvs lava_beam 114074 17587343 58625 7.19 352566 972441 7.5 36.0 22.0% 0.0% 0.0% 0.0% 28.80sec 17587343 300.00sec
mb_lvs mb_lvs lava_beam_overload 114738 21813753 72713 10.80 290361 802037 11.0 54.0 22.2% 0.0% 0.0% 0.0% 40.50sec 21813753 300.00sec
mb_lvs mb_lvs lava_burst 51505 48651903 162175 11.11 253506 876112 55.5 55.5 100.0% 0.0% 0.0% 0.0% 5.32sec 48651903 300.00sec
mb_lvs mb_lvs lava_burst_overload 77451 24290184 80968 7.04 209114 689722 35.2 35.2 100.0% 0.0% 0.0% 0.0% 8.35sec 24290184 300.00sec
mb_lvs mb_lvs volcanic_inferno 205533 5602083 18674 19.01 47030 95892 41.5 95.0 24.4% 0.0% 0.0% 0.0% 6.68sec 5602083 300.00sec
mb_lvs mb_lvs lightning_bolt 188196 12554121 41848 7.67 227915 615989 38.3 38.3 25.7% 0.0% 0.0% 0.0% 7.66sec 12554121 300.00sec
mb_lvs mb_lvs lightning_bolt_overload 45284 11980133 39934 8.65 192165 521062 43.3 43.3 25.7% 0.0% 0.0% 0.0% 9.11sec 11980133 300.00sec
mb_lvs mb_lvs potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
mb_lvs mb_lvs spectral_owl 242570 13616891 45390 18.92 116064 236771 3.0 94.6 23.1% 0.0% 0.0% 0.0% 120.33sec 13616891 300.00sec
mb_lvs mb_lvs spectral_blast 246442 6387653 21292 7.60 135409 276235 38.0 38.0 23.3% 0.0% 0.0% 0.0% 6.91sec 6387653 300.00sec
mb_lvs mb_lvs stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.25sec 0 300.00sec
mb_lvs mb_lvs totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.65sec 0 300.00sec
mb_lvs mb_lvs_primal_fire_elemental fire_blast 57984 25646491 133800 30.28 213208 426453 96.7 96.7 24.4% 0.0% 0.0% 0.0% 2.99sec 25646491 191.68sec
mb_lvs mb_lvs_greater_lightning_elemental lightning_blast 191726 7227061 177358 55.48 156714 313664 37.7 37.7 22.4% 0.0% 0.0% 0.0% 7.49sec 7227061 40.75sec
tgt_eq tgt_eq ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.98sec 0 300.01sec
tgt_eq tgt_eq augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq chain_lightning 188443 56879082 189593 33.40 242424 659330 42.1 167.0 23.6% 0.0% 0.0% 0.0% 6.35sec 56879082 300.01sec
tgt_eq tgt_eq chain_lightning_overload 45297 66867043 222885 45.48 209126 570349 51.1 227.4 23.5% 0.0% 0.0% 0.0% 9.50sec 66867043 300.01sec
tgt_eq tgt_eq earth_shock 8042 18980608 63267 1.90 1377893 3821361 9.5 9.5 25.3% 0.0% 0.0% 0.0% 31.65sec 18980608 300.01sec
tgt_eq tgt_eq earthquake 61882 0 0 0.00 0 0 48.3 0.0 0.0% 0.0% 0.0% 0.0% 5.81sec 0 300.01sec
tgt_eq tgt_eq earthquake_ 77478 174368157 581214 293.58 85041 235409 286.9 1468.0 22.4% 0.0% 0.0% 0.0% 0.97sec 174368157 300.01sec
tgt_eq tgt_eq seismic_lightning 243073 56717804 189055 14.68 553311 1531471 73.4 73.4 22.4% 0.0% 0.0% 0.0% 4.35sec 56717804 300.01sec
tgt_eq tgt_eq elemental_blast 117014 17113559 57044 3.99 596508 1653549 19.9 19.9 24.8% 0.0% 0.0% 0.0% 15.27sec 17113559 300.01sec
tgt_eq tgt_eq elemental_blast_overload 120588 9060991 30203 2.51 501088 1388544 12.6 12.6 24.8% 0.0% 0.0% 0.0% 23.21sec 9060991 300.01sec
tgt_eq tgt_eq fire_elemental 198067 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.73sec 0 300.01sec
tgt_eq tgt_eq flame_shock 188389 5408756 18029 5.21 88215 249843 26.0 26.0 74.0% 0.0% 0.0% 0.0% 11.50sec 50051271 300.01sec
tgt_eq tgt_eq flame_shock ticks -188389 44642515 148808 60.12 48143 185493 26.0 300.6 73.1% 0.0% 0.0% 0.0% 11.50sec 50051271 300.01sec
tgt_eq tgt_eq flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq insidious_corruption ticks -243941 4361107 14537 9.60 73523 149472 5.1 48.0 22.8% 0.0% 0.0% 0.0% 60.37sec 4361107 300.01sec
tgt_eq tgt_eq lava_beam 114074 17587618 58624 7.19 352093 976014 7.5 35.9 22.0% 0.0% 0.0% 0.0% 28.83sec 17587618 300.01sec
tgt_eq tgt_eq lava_beam_overload 114738 22001622 73337 10.85 291061 805938 11.0 54.2 22.2% 0.0% 0.0% 0.0% 40.53sec 22001622 300.01sec
tgt_eq tgt_eq lava_burst 51505 45390569 151299 11.09 252657 818926 55.4 55.4 100.0% 0.0% 0.0% 0.0% 5.33sec 45390569 300.01sec
tgt_eq tgt_eq lava_burst_overload 77451 23308212 77692 7.05 213770 661197 35.3 35.3 100.0% 0.0% 0.0% 0.0% 8.29sec 23308212 300.01sec
tgt_eq tgt_eq volcanic_inferno 205533 5610560 18701 19.02 47043 95911 41.3 95.1 24.4% 0.0% 0.0% 0.0% 6.57sec 5610560 300.01sec
tgt_eq tgt_eq lightning_bolt 188196 12610272 42033 7.67 227722 616845 38.4 38.4 25.9% 0.0% 0.0% 0.0% 7.64sec 12610272 300.01sec
tgt_eq tgt_eq lightning_bolt_overload 45284 11972015 39906 8.65 192390 520364 43.3 43.3 25.7% 0.0% 0.0% 0.0% 9.07sec 11972015 300.01sec
tgt_eq tgt_eq potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.01sec
tgt_eq tgt_eq spectral_owl 242570 13592749 45308 18.90 116064 236771 3.0 94.5 23.0% 0.0% 0.0% 0.0% 120.34sec 13592749 300.01sec
tgt_eq tgt_eq spectral_blast 246442 6384990 21283 7.59 135409 276235 38.0 38.0 23.2% 0.0% 0.0% 0.0% 6.89sec 6384990 300.01sec
tgt_eq tgt_eq stormkeeper 205495 0 0 0.00 0 0 5.2 0.0 0.0% 0.0% 0.0% 0.0% 62.17sec 0 300.01sec
tgt_eq tgt_eq totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 118.65sec 0 300.01sec
tgt_eq tgt_eq_primal_fire_elemental fire_blast 57984 25651896 133912 30.28 213179 426409 96.7 96.7 24.5% 0.0% 0.0% 0.0% 2.98sec 25651896 191.56sec
tgt_eq tgt_eq_greater_lightning_elemental lightning_blast 191726 7232993 177281 55.47 156718 313585 37.7 37.7 22.3% 0.0% 0.0% 0.0% 7.49sec 7232993 40.80sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
1011243.0 1011243.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 11.82% 11.82% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:11.82%

Trigger Attempt Success

  • trigger_pct:99.01%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 10.81% 10.81% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:10.81%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.97% 10.97% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.97%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.10% 11.10% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.58% 10.58% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.58%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 9.85% 9.85% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:9.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.50% 11.50% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.50%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.99% 10.99% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.43% 7.43% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.43%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 4.95% 4.95% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:4.95%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 1011243.00
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 60137
Mean 300.01
Minimum 239.92
Maximum 360.08
Spread ( max - min ) 120.16
Range [ ( max - min ) / 2 * 100% ] 20.03%
Standard Deviation 35.2444
5th Percentile 245.63
95th Percentile 354.37
( 95th Percentile - 5th Percentile ) 108.74
Mean Distribution
Standard Deviation 0.1437
95.00% Confidence Intervall ( 299.73 - 300.29 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 531
0.1% Error 53017
0.1 Scale Factor Error with Delta=300 11
0.05 Scale Factor Error with Delta=300 43
0.01 Scale Factor Error with Delta=300 1061
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 60137
Mean 1037142.72
Minimum 877601.52
Maximum 1221428.45
Spread ( max - min ) 343826.94
Range [ ( max - min ) / 2 * 100% ] 16.58%
Standard Deviation 42293.3200
5th Percentile 969875.10
95th Percentile 1109423.70
( 95th Percentile - 5th Percentile ) 139548.59
Mean Distribution
Standard Deviation 172.4650
95.00% Confidence Intervall ( 1036804.70 - 1037480.75 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 64
0.1% Error 6388
0.1 Scale Factor Error with Delta=300 15269585
0.05 Scale Factor Error with Delta=300 61078339
0.01 Scale Factor Error with Delta=300 1526958470
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 257008381 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

Fluffy_Pillow_Beast1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Beast1
Resource RPS-Gain RPS-Loss
Health 0.00 325407.13
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Beast1 Fight Length
Count 60137
Mean 45.11
Minimum 15.00
Maximum 87.81
Spread ( max - min ) 72.81
Range [ ( max - min ) / 2 * 100% ] 80.69%
Standard Deviation 7.9241
5th Percentile 32.04
95th Percentile 58.08
( 95th Percentile - 5th Percentile ) 26.05
Mean Distribution
Standard Deviation 0.0323
95.00% Confidence Intervall ( 45.05 - 45.18 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1186
0.1% Error 118513
0.1 Scale Factor Error with Delta=300 1
0.05 Scale Factor Error with Delta=300 3
0.01 Scale Factor Error with Delta=300 54
DPS
Sample Data Beast1 Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Beast1 Priority Target Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Beast1 Damage Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Beast1 Damage
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Beast1 Damage Taken Per Second
Count 60137
Mean 322236.99
Minimum 30421.10
Maximum 823380.51
Spread ( max - min ) 792959.41
Range [ ( max - min ) / 2 * 100% ] 123.04%
HPS
Sample Data Beast1 Healing Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Beast1 Healing Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Beast1 Heal
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Beast1 Healing Taken Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Beast1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Beast1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Beast1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 257052563 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Beast1"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Heavy_Spear1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Heavy_Spear1
Resource RPS-Gain RPS-Loss
Health 0.00 99421.85
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Heavy_Spear1 Fight Length
Count 60137
Mean 215.65
Minimum 169.92
Maximum 260.08
Spread ( max - min ) 90.16
Range [ ( max - min ) / 2 * 100% ] 20.90%
Standard Deviation 26.3582
5th Percentile 175.63
95th Percentile 255.00
( 95th Percentile - 5th Percentile ) 79.37
Mean Distribution
Standard Deviation 0.1075
95.00% Confidence Intervall ( 215.44 - 215.86 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 574
0.1% Error 57391
0.1 Scale Factor Error with Delta=300 6
0.05 Scale Factor Error with Delta=300 24
0.01 Scale Factor Error with Delta=300 594
DPS
Sample Data Heavy_Spear1 Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Heavy_Spear1 Priority Target Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Heavy_Spear1 Damage Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Heavy_Spear1 Damage
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Heavy_Spear1 Damage Taken Per Second
Count 60137
Mean 99654.42
Minimum 0.00
Maximum 326804.72
Spread ( max - min ) 326804.72
Range [ ( max - min ) / 2 * 100% ] 163.97%
HPS
Sample Data Heavy_Spear1 Healing Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Heavy_Spear1 Healing Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Heavy_Spear1 Heal
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Heavy_Spear1 Healing Taken Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Heavy_Spear1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Heavy_Spear1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Heavy_Spear1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 257052563 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Heavy_Spear1"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Heavy_Spear2 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Heavy_Spear2
Resource RPS-Gain RPS-Loss
Health 0.00 98739.83
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Heavy_Spear2 Fight Length
Count 60137
Mean 215.65
Minimum 169.92
Maximum 260.08
Spread ( max - min ) 90.16
Range [ ( max - min ) / 2 * 100% ] 20.90%
Standard Deviation 26.3582
5th Percentile 175.63
95th Percentile 255.00
( 95th Percentile - 5th Percentile ) 79.37
Mean Distribution
Standard Deviation 0.1075
95.00% Confidence Intervall ( 215.44 - 215.86 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 574
0.1% Error 57391
0.1 Scale Factor Error with Delta=300 6
0.05 Scale Factor Error with Delta=300 24
0.01 Scale Factor Error with Delta=300 594
DPS
Sample Data Heavy_Spear2 Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Heavy_Spear2 Priority Target Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Heavy_Spear2 Damage Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Heavy_Spear2 Damage
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Heavy_Spear2 Damage Taken Per Second
Count 60137
Mean 98995.08
Minimum 0.00
Maximum 346270.05
Spread ( max - min ) 346270.05
Range [ ( max - min ) / 2 * 100% ] 174.89%
HPS
Sample Data Heavy_Spear2 Healing Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Heavy_Spear2 Healing Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Heavy_Spear2 Heal
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Heavy_Spear2 Healing Taken Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Heavy_Spear2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Heavy_Spear2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Heavy_Spear2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 257052563 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Heavy_Spear2"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast1
Resource RPS-Gain RPS-Loss
Health 0.00 469787.77
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast1 Fight Length
Count 60137
Mean 98.37
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.33%
Standard Deviation 12.0982
5th Percentile 80.00
95th Percentile 119.37
( 95th Percentile - 5th Percentile ) 39.37
Mean Distribution
Standard Deviation 0.0493
95.00% Confidence Intervall ( 98.27 - 98.46 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 582
0.1% Error 58108
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 125
DPS
Sample Data Pack_Beast1 Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast1 Priority Target Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast1 Damage Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast1 Damage
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast1 Damage Taken Per Second
Count 60137
Mean 470237.76
Minimum 273097.33
Maximum 765387.08
Spread ( max - min ) 492289.76
Range [ ( max - min ) / 2 * 100% ] 52.34%
HPS
Sample Data Pack_Beast1 Healing Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast1 Healing Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast1 Heal
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast1 Healing Taken Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 257052563 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast1"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast2 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast2
Resource RPS-Gain RPS-Loss
Health 0.00 453331.75
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast2 Fight Length
Count 60137
Mean 98.37
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.33%
Standard Deviation 12.0982
5th Percentile 80.00
95th Percentile 119.37
( 95th Percentile - 5th Percentile ) 39.37
Mean Distribution
Standard Deviation 0.0493
95.00% Confidence Intervall ( 98.27 - 98.46 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 582
0.1% Error 58108
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 125
DPS
Sample Data Pack_Beast2 Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast2 Priority Target Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast2 Damage Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast2 Damage
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast2 Damage Taken Per Second
Count 60137
Mean 453892.13
Minimum 256056.45
Maximum 743832.14
Spread ( max - min ) 487775.68
Range [ ( max - min ) / 2 * 100% ] 53.73%
HPS
Sample Data Pack_Beast2 Healing Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast2 Healing Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast2 Heal
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast2 Healing Taken Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 257052563 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast2"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast3 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast3
Resource RPS-Gain RPS-Loss
Health 0.00 453313.46
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast3 Fight Length
Count 60137
Mean 98.37
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.33%
Standard Deviation 12.0982
5th Percentile 80.00
95th Percentile 119.37
( 95th Percentile - 5th Percentile ) 39.37
Mean Distribution
Standard Deviation 0.0493
95.00% Confidence Intervall ( 98.27 - 98.46 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 582
0.1% Error 58108
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 125
DPS
Sample Data Pack_Beast3 Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast3 Priority Target Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast3 Damage Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast3 Damage
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast3 Damage Taken Per Second
Count 60137
Mean 453888.27
Minimum 254133.70
Maximum 747235.92
Spread ( max - min ) 493102.22
Range [ ( max - min ) / 2 * 100% ] 54.32%
HPS
Sample Data Pack_Beast3 Healing Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast3 Healing Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast3 Heal
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast3 Healing Taken Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 257052563 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast3"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast4 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast4
Resource RPS-Gain RPS-Loss
Health 0.00 453403.18
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast4 Fight Length
Count 60137
Mean 98.37
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.33%
Standard Deviation 12.0982
5th Percentile 80.00
95th Percentile 119.37
( 95th Percentile - 5th Percentile ) 39.37
Mean Distribution
Standard Deviation 0.0493
95.00% Confidence Intervall ( 98.27 - 98.46 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 582
0.1% Error 58108
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 125
DPS
Sample Data Pack_Beast4 Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast4 Priority Target Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast4 Damage Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast4 Damage
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast4 Damage Taken Per Second
Count 60137
Mean 453978.29
Minimum 264926.52
Maximum 735544.96
Spread ( max - min ) 470618.43
Range [ ( max - min ) / 2 * 100% ] 51.83%
HPS
Sample Data Pack_Beast4 Healing Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast4 Healing Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast4 Heal
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast4 Healing Taken Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast4 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast4Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast4 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 257052563 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast4"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast5 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast5
Resource RPS-Gain RPS-Loss
Health 0.00 453519.17
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast5 Fight Length
Count 60137
Mean 98.37
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.33%
Standard Deviation 12.0982
5th Percentile 80.00
95th Percentile 119.37
( 95th Percentile - 5th Percentile ) 39.37
Mean Distribution
Standard Deviation 0.0493
95.00% Confidence Intervall ( 98.27 - 98.46 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 582
0.1% Error 58108
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 125
DPS
Sample Data Pack_Beast5 Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast5 Priority Target Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast5 Damage Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast5 Damage
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast5 Damage Taken Per Second
Count 60137
Mean 454070.44
Minimum 261993.24
Maximum 744150.70
Spread ( max - min ) 482157.45
Range [ ( max - min ) / 2 * 100% ] 53.09%
HPS
Sample Data Pack_Beast5 Healing Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast5 Healing Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast5 Heal
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast5 Healing Taken Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast5 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast5Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast5 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 257052563 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast5"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Pack_Beast6 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Pack_Beast6
Resource RPS-Gain RPS-Loss
Health 0.00 453815.02
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Pack_Beast6 Fight Length
Count 60137
Mean 98.37
Minimum 80.00
Maximum 120.00
Spread ( max - min ) 40.00
Range [ ( max - min ) / 2 * 100% ] 20.33%
Standard Deviation 12.0982
5th Percentile 80.00
95th Percentile 119.37
( 95th Percentile - 5th Percentile ) 39.37
Mean Distribution
Standard Deviation 0.0493
95.00% Confidence Intervall ( 98.27 - 98.46 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 582
0.1% Error 58108
0.1 Scale Factor Error with Delta=300 2
0.05 Scale Factor Error with Delta=300 5
0.01 Scale Factor Error with Delta=300 125
DPS
Sample Data Pack_Beast6 Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Pack_Beast6 Priority Target Damage Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Pack_Beast6 Damage Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Pack_Beast6 Damage
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Pack_Beast6 Damage Taken Per Second
Count 60137
Mean 454374.04
Minimum 252706.00
Maximum 736656.66
Spread ( max - min ) 483950.66
Range [ ( max - min ) / 2 * 100% ] 53.25%
HPS
Sample Data Pack_Beast6 Healing Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Pack_Beast6 Healing Per Second (Effective)
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Pack_Beast6 Heal
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Pack_Beast6 Healing Taken Per Second
Count 60137
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Pack_Beast6 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Pack_Beast6Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Pack_Beast6 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 257052563 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Pack_Beast6"
spec=unknown
level=113
race=none
role=auto
position=back
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.